ELF4Z4 (444  Q,, , ((( Qtd/lib/ld-linux.so.2GNUaoEDhiU9(TG,S 4=cPQ_f\MbVj>eNA;0Ok)%d]5lg^ 2Y7-F&XHm![n@aLC *#.'" +3 B86RWZI$?`KJ:1</>>6pE)]gl@vD5rTk=$.:s.69gU]ry}W>a= j2$L1r =#4  z:dJVLX"FFD>9= F@=d:qU7>[bk; vpC?6?4Arj@NV>5 2/  r4`=& @\zg2v Kgc:\"libm.so.6_Jv_RegisterClasses__gmon_start__libdl.so.2powdlsymdlclosedlopenlibc.so.6strcpychrootioctl__strtod_internalstdoutrecvstrerrormemmove__strtol_internalusleepqsortfscanffgetsmemcpydup2getuidsystemfeofmallocvsnprintfrecvfromgethostbyaddrrmdirsocketselectreaddirfflushstrncasecmpsend__stack_chk_failchmodacceptstrrchr__ctype_tolower_locfprintfstrcatbindinet_addrchdirinitgroupssetsockoptfseekstrcasestrstrstrsetgidsignalstrncmpstrncpyunlinkstrcasecmpsendtostrtoklistenforksscanfexecvstrncatfreadgettimeofdaylocaltimememsetftellsrandinet_ntoaopendir__assert_failstrcmpgetpwuidgethostbynamegetpwnamgethostnamesprintffclosedifftime__ctype_b_locstrftimefwrite__xstat__errno_locationgetgrnamfopen_IO_putc__ctype_toupper_loc_IO_stdin_used_exit__libc_start_mainstrlenstrchrfputssetsidclosedirsetuidmkdirfreegetsocknameGLIBC_2.0GLIBC_2.1GLIBC_2.4GLIBC_2.3 ii .0ii ii Rii ii ii ii  k ,    $ ( , 0 4  8  <  @  D  H L P T X \ ` d h l p t x |       ! " # $ % & ' ( ) * + -ę .ș /̙ 0Й 1ԙ 3ؙ 4ܙ 5 6 7 8 9 : ; < = > ? @ A B C D E F$ G( H, I0 J4 K8 L< M@ ND OH PL QP RT SX T\ U` Vd Wh Xl Yp Zt [x \| ] ^ ` a b c d e g h i j k l m nU@#5 % % h% h% h% h%$ h %( h(%, h0%0 h8p%4 h@`%8 hHP%< hP@%@ hX0%D h` %H hh%L hp%P hx%T h%X h%\ h%` h%d h%h h%l h%p hp%t h`%x hP%| h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0%ę h` %ș hh%̙ hp%Й hx%ԙ h%ؙ h%ܙ h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h%$ h %( h(%, h0%0 h8p%4 h@`%8 hHP%< hP@%@ hX0%D h` %H hh%L hp%P hx%T h%X h%\ h%` h%d h%h h%l h%p hp%t h`%x hP%| h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`% hHP1^PTRh hж QVhUS[trX[ÐU= t Ț ҡȚ u ÐU( tt $( ÐU]Ít&' U]Ѓ   Ív'"U]B: Í'U1҉JƂ`!#BƂ #Ɓ`!#Ɓ #Jƀ`!#ƀ #BƁ`!#Ɓ #Jƀ`!#ƀ #BƁ`!#Ɓ #J ƀ`!#ƀ #Ɓ`!#Ɓ #o t&B`!J `! B`! J`! B`! J`! B`! `! u    !. . . . .!.|!.o!.n!.e!.r!0 0s!1 1t!2 2u!3 3v!4 4w!5 5x!6 6y!7 7z!8 8{!9 9p![ []q!] ]`!(}!( (b!)!) )_!>m!<~!=a!= =Ðt&UUtv u]Ð&"U@X]Í&'"UBB] U]CÐU]CÐU"Bv- }E fEm]mMQ$Z эv !U"勑P !"P !"P ] "UBB(vBr vZ]Z]Ðt&Z]Í&UE w$ ]ø ]ʸ ] ] ] ] ] ] ]ܸ ]Ӹ Ð&U}M U fUm]mE9A(uA(P Q(m]mEƒA$Q(É'UE]Ð&UVS1ۃCt;!t$CCt;!t$tCsCt;!t$KCsCt;!t$"CsCt;!t$CsCt;!t$CsCt;!t$CsCt;!t$~C[^]Ðt&US=!ЍX 9E9 1ɸS!S 9~Ћ( 9~Ћ0 9~Ћ8 9~Ћ@ 9~ЋH 9~ЋP 9~ЋX 9~Ћ` 9~Ѓ $d!$D$LD$ !$=!S~S !@9!1ۋ A!$ C  $ !C $ !C $ !C $ !C $ !C x$ !C xb$ !C xE$  !$[] ! !k[]D$ @ D$rD$ $ !$c&US"B$!1ҋC9JCʅt9t{Ctm9tiQCt[9tWQCtI9tEQCt79t3QCt%9t!QCt9tQZ "R$Y[]Í&US"C$8[[]Í'US"S$fP$[[]Í&US"B$ا$}tu Ht>; t9D$\$<$; uD$\$<$uōv :u"C[^_]Ë5"+!V[^_]ÍU"B}E fEm$mÍt&U8u5"]}^$蠘"B}EM fMm]m]܋B$jt:tut$D$  $W 9$!5"P$E^3t$D$  $W UT$$ŏ="E_]u}]Ét$D$  $W ML$$腏}X@$:M|$ $ÉD$YU$讍t$D$  $W f$N|$\$E$$c5"EXJvUWVS ='t $p "K1ۉ $"NjBB<$)`'+|$$s`'|$$~`'|$$X^`'|$$2^`'|$$ ty^`'ts|$$t[^`'tU|$$t=^`'t7|$$t^|$$  [^_]Á<`' [^_]É|$$ ߍUWVS ='t $p B"K1ۉ $_"ƋBB4$y`'Jt$$.d''t$$ h't$$`'t$${`'t$$e`'t$$?ty_`'tst$$!t[_`'tUt$$t=_`'t7t$$t_*t$$  [^_]É4`' [^_]ÍvU$ǹ ÉUED$$0Ðt&U"B}E fEm]mEw$ $ 01$ع Zɸ0'Ã=''t$( 'ɸp'ɸ'Ív'UWVS M ƒ ;  ] Ƃ uI<&EMD$ $ 95~WG t MQt܉$E$U$D=vD$$d Y뉋E[^_]Í&'UVS uU N$ts:tn}] f] m]mE9F(tZP N(m]m]ك^$N(P m\$m$T$+F [^]Ð 1[^]Í&F(띋N [^]፶UVS uMML$ U D$$ T$p tS4$D$V D$ $ /FCpǃǃP [^]Ít&4$V4$VVD$ $m  [^]É'UWVS,"eE1 jٽƅ f٭۝٭Bi 9t+D$ $Me3 ,[^_]P ٭۝٭| t< t< t9t ui) u29u-5"FT D$  $9 !)"C D$( $'UVS " j}E fEm]muwoi; t$  [^]Ëu< $,iǂǂ [^]$D p [^]|ʃt&iL$$D$z $,$b  dt&'U; t~ ,; D; \;  t; ; ;  ; Ë"BzDMk"@@zD7g "AzD b"BzD \"@{DX "A@{DS"B{DM"@{D&'US"K $舌"ËB$u$D$t"$觌[]á"@[]Ív'U8 "]u}1A$"C]tvfth0ft[ HftM`ft?xft2 ft$=tC]u}]ÿ~:tD$\4$ù>/tD$^, 4$u}Et$$ ] f]m]miD$ӁUD$$Mtwua$軂# "R$Y ui dž ="Gidž $ o-ǃǃ "S$X |$u ɉ `"Q$[= D$t$$v$n"C&'U(]"uC(}E fEm]mKu $'"ËB$t$\$$]u]Ív'UWVSL="5d'_G}U fUm]mO( $贈"}؅EB4}E fEm]mB@m]mBLm]mBXm]mBd]tiEشǀs(U܍<iMشD$$I.s(X$w,D$Ƈw\$xD$ D$ 4$$Mԉ$D$L$Ƈ\$D$ D$ 4$_$]{Et`^ M܉u؉``^ }Eރ3``^ U fUm۟m ݟx(6d @A 2``^ h 2``^ 2``^ lV2``^ ,2``^ 8#2``^ d(2``^  .2``^ T42``^ t`Y:3``^ 0UԉD$E苏T$U$D$E؉L$MT$D$L$ ~L[^_]ËD$Eԋ$D$EL$MD$ E؉L$MD$L$2\L$Mԋ$L$MD$EL$ M؉D$EL$D$D$Eԋ$D$EL$MD$ E؉L$MD$L$L$Mԋ$L$MD$EL$ M؉D$EL$D$fXD$Eԋ$D$EL$MD$ E؉L$MD$L$"L$Mԋ$L$MD$EL$ M؉D$EL$D$D$Eԋ$D$EL$MD$ E؉L$MD$L$PL$Mԋ$L$MD$EL$ M؉D$EL$D$VD$Eԋ$D$EL$MD$ E؉L$MD$L$M܋]ԋEL$M\$]؉D$T$UL$ \$$t`^ T$1&U "A$YUT$$*rEt$c"?Pá"1҉PUS"C$ "QÉ$$D$D$P"$X[] U "Y;'t $UWVS 5")FFك 9ZtltQt&t2tGك Gك Gك Gك Gnك GQك G"ك 9^ [^_]ك GQG(G4G@GLGXGdv]ٍJT9sGpk$  [^_]Ë"BB~Z [^_]nW@ؐ(q؉X ؉L؉Y؉n؉OZ [^_]Í&'UWVS 5")FFك 9ZtltQt&t2tGك Gك Gك Gك Gnك GQك G"ك 9^ [^_]ك GQG(G4G@GLGXGds]ٍJT9sGpk$0  [^_]Ë"BB~Z [^_]nW@ؐ(q؉X ؉L؉Y؉n؉OZ [^_]Í&'"U@X]Í&'"U@X]Í&'"U@X]Í&'U"D$ D$@}$U fUm\$mÍ&'US"B$|"$g[] US "Qd'$WÍ@*iӴ!X !!!!!!!!!!!!!!![]$ 'US !<d'$UÍ@v $ 詄iô[]X Ð&US"Bd'$BUÃ;`'t%$mU‹u"+d'S[]Ë "A[]Í'UWVS "K d' $T"rËB($zEt~9`'~^< 9`'~J$TƋuT>t$ytՋM$L$u‹="+5d'w [^_]Ë5"F [^_]$ Yqt&UWVS,5"^d'$T "EQ$LyËEuy=!\$$@ % t8u\$$`T = L$D$<$~ "$+y,[^_]J}  iUX U^ :u ^ :Ku^ :C  'U ؉D$ D$A D$$    t& ܺ  8 F 8] $t$ |$$D$ (T$,D$ED$$  D$   k]$L$T$t$ |$B uE$X ui]X  uMh\$U,$t&'UVS0"@]D$ $@ $ D$iUD$ D$ $D$Zu>R}EM fMm]mML)Ѓ>tvtbtNt:t%tL>vL>L>L>L>L>L>t|9tN~Ltotft]0tT|tKtBt9`>t.9u4$pD0"4$Uue[^]Ë5"Fe[^]Ðt&UVSU;2 }DRӍ4 "T1 $tD$$2 D$j9ȃ2 [^]ÍUS"B]$q$蟽\$}ED$E fEm$mi[]Ít&'U8"] u}j}$E fEm]m]E$Ei; t$ 蜸]u}]Í E]E]9|rEMU苰L$T$4$:}M܋E9|]}$ p]}Y]K$u܋L$ÉT$$貼4$:$( 蕷Uu}$x$m D$h u u}]Ð$ ?uء!t!u}]!u}]Ít&UWVS"eE1Sd'$RL "q(y4AA@@ٝLALٝPv7$T 虶5"FEe3 e[^_]Ít&ٽi´D$ $@ X d f٭۝X٭$ D$ݷ$D$ D$ D$M8x $T$ D$A D$@OM!‰%t 08)щD;ٽx4م4\ f٭۝|٭|x9Љ\4م4٭۝|٭|уxx91Džh\مL٭۝`٭ l4ƅ>D\6xh9ىt(DDžpDT4$zD0`U``@hU$D$A D$@L$ 艹E$fcp 9\D$dUXt$D$T$ D$q D$<$ȮpLh>tAp9\~3t9ht&xt`v`i`h9tNٽمP f٭۝|٭|r "A1"ۅh[4Džl ƅ><&XdD$+ \$4$萭="GkLhl\F hM $D$V D$@|$ 螷U${aEt$LD$ D$[ D$<$mh>hXdD$ D$ \$4$跬iXdD$ |$ $蒬DU$uD$@D$z 诧E$`xXdt$ \$D$ ۅ ɉ|$ $\$ \$  h]D$A D$@$|$ NME!‰%t u8)9Dˉ<HD}+<<$D$XHD$ ;H titFt&t]fD$D$ $菨UD$D$ $qMD$D$  $SED$D$ $5]D$D$ $UD$D$ $MD$D$  $ۧ;HM $]D$D$ 讧U$D$D$ 蓧$]D$D$ xED$D$ $]M $D$D$ BU$D$D$ 'D$D$ $ED$D$ $;H<M $]XUdEt$D$T$D$ D$K |$ $ Epl؃MMpt$D$ D$D D$@ $&p}|$$D$$pgfffp)9pXdT$ D$ D$ $>ƅqF }4$+UD0h$D$V D$@L$ aE$>\Xdt$|$L$ D$d T$$輧ƅU$[h}lD$5 D$@\$ LL$<$бME!‰%t u8T)9@G@}T<$D$ЍD$ {@;TtntKt&t$]D$D$ $@MD$D$  $UD$D$ $ΣED$D$ $谣]D$D$ $蒣MD$D$  $tUD$D$ $V;TU$]D$D$ )M $D$D$ $]D$D$ ED$D$ $آU$D$D$ 轢M $D$D$ 袢D$D$ $芢ED$D$ $o;TXEd}D$ D$|$D$; T$ $蘤&'UWVS| "eE1Q$ dD$@D$E$脟Et%0< Uv0< Bu}<$ E]D$ $D$ }$@ $ D$gD$ D$ <$D$[u>tvUuRػED$4$t[L>tD9]u݉tE"[Ee3uVe[^_]Ã}uE!5"FS$뵍uD$@D$ 4$臠E'UX"d']u}BZ$=$<~w ~ ~ ]u}]$8M $Eʨ} M fMm]mE܅2Kt$(BD$$Z\$ r t$BD$ZiѴ$x l\$iߴj^ j^ t$j^ j^ D$ |$t$lËD \$<׍4P 4$ \$D$$]niôiִ$ 8X 8X L$|$D$ $ s'Ul`^ ;  t."  B$`$ D$藧$OÍ'U "]u}Q$p` u$ ]u}] u! UWVS "Qy$`ơ"@(]@4`']1d't$$艦uD$$' $'L$w W$'T$d w$'t$Q \$$'q }E E fEm\$m$'E }E ] f]m\$m$' [^_]Ét$${ [^_]É'UWVS"Zd'3$^$=ك s(=k8s(1;(M}=s(M쉺;(AMQA yQAq yك}U fUmY$mكmY(mكmY,mكmY0m$KZ[^_]ÍvD$$' |$$' ك}$'M fMm\$mk ك}$'E fEm\$mB ك}$'U fUm\$m $'t$$'L$ $'D$$'|$a $'T${$'t$5 U"Bd'$XÐUS"ZuI4D$É$["H d' $6$D$0Y;(u6[]ËJ d' $6H\$$,[]Ít`^ ieܯD$$D$ "Qd'$26xU $D$[]Ív'US"ZuNDD$É$Z"@}M fMm\$m$;X;(u9[]B}U fUm]m]J\$$.[]Át`^ ieܯD$$D$ "A}U fUxU m\$m$[]Í'US"Zu[D "QÉ$AZ$董$D$Y"H $Z$D$V;(u*[]ËJ $YL\$$P[]Ë"t`^ B$Y$ieܯ$L$D$"B$YxU $D$[]ÉUS"Zu;DD$É$X"H$L$V;(u$[]ËZv\$$[]Ít&t`^ ieܯD$$D$ٿ "xU Q$T$[]Ð&US"Zu;D$É$"X"H$L$W;(u$[]ËZ\$$[]Ít&t`^ ieܯD$$D$ "A}U fUxU m\$m$[]Ðt&US"ZuND$É$RW"@}M fMm\$m$T;(u9[]B}U fUm]m]\$$^[]Át`^ ieܯD$$D$! "A}U fUxU m\$m$[]Í'US"ZuND$É$RV"@}M fMm\$m$T;(u9[]B}U fUm]m]\$$^[]Át`^ ieܯD$$D$! "A}U fUxU m\$m$[]Í'US"ZuND$É$RU"@}U fUm\$m$;T ;(u9[]B}M fMm]m]\$$^[]Át`^ ieܯD$$D$!"B}M fMxU m\$m$[]Í'US !Ypd'$VككtZڞr8 vQvVw=$oVٛ[]Ív r% ؃[]Ð 맍t&s렉'US"C$P$[[]Ít&'US"Cd'$:1RP,$[ []ÉU"@}UfUmmXÐ&U"@}UfUmmXÐ&UWVS "A}] f]m]mA$SU='E`'t[^_]ÿ``^ t`^ ߃;``^ (6d @A  ;``^ uh ;``^ ;``^ V;``^ 5,;``^ u8#;``^ (;``^ .;``^ 5T4;``^ uY:>``^ ,M $TD$ 4$D$RE4$D$6PU4$T$N5;(u4$D$$D$莸 xU D$ $ExU D$$s]=xU \$<$[^_]ËM $蓚$D$ D$RE$D$uOU$h T$M;``^ KM $?$D$ D$QE$D$!OU$T$|M;``^  M $$D$ D$\QE$D$NU$VT$(M;``^ M $藙$D$ D$QE$D$yNU$,T$L;``^ M $C$D$ D$PE$D$%NU$8#T$L;``^ KM $$D$ D$`PE$D$MU$(T$,L;``^  M $蛘$D$ D$ PE$D$}MU$.T$K;``^ M $G$D$ D$OE$D$)MU$T4T$K;``^ M $D$ $D$dOE$D$LU$T$6KFM $讗D$ $t`^ D$OE$t`^ D$LU$t`^ T$J+UWVS,"Bd'$(EwE"߻ Z$M iEX Eu }G ,[^_]$˻ dW뭋}x<$ٖ$ϖ eD$\$<$4D$ <$謓t<$萖D$ D$U$M|$]$I;(}U fU m]mEoUt`^ E``^ ] tMtô@A (uôt!Ut`^ Ltu;M荳t!Mt`^ TtU;U荳h t!Ut`^ LtM;$U荳 t!Mt`^ TtU;4U荳V t!Ut`^ LtM;U荳, t!Mt`^ TtU;TU荳8# t!Ut`^ LtM;U荳( t!Mt`^ TtU;U荳. t!Ut`^ LtM;T4u1Ut`^ Lu; E<$D$ $D$]K|$$AG,[^_]É<$豓D$]$t`^ ieܯD$05xU D$ 4$* xU |$ $x$ SU;1E!<$"D$ $D$J|$$wFU,<$D$ $D$QJ|$$5FEl<$蠒D$ 4$D$J|$4$E$m D$辵ÍUE]@@Ít&UWVS$"=`'5d'PU؋4"@](v+5d'\4"ރ9=`'Ӌu؛u$ك}E fEm]mM@tكU؃M أ]ك؃أA]ك؃أA$]E34"9=`'A"+5d'p$[^_]Ð&"U@PBBX]Ít&'"UBJAAu(Zɡ"X"Z ]؍v'Uu]"K $C"ƋB$C4$vt\$$]u]Ét$$ 輈]u]ÉUu]"B$sCD$ $Yu !t#"4$u]u]Í"C?]u]É'U"eE1]u}Bp$BD$  D$ D$<$D$p$Ɖ$D$ <$Zt\D$4$踋$蠉$蘌 "Ytt$$m Ee3u&]u}]Í&|$$! б'US"K $A"ËB$A\$$聎[]ÍvUS$ $D$S "$A[] '"UL`^ Zt]Ð]麇v'U(]u} "Q$0A"C}E fEm]muC(m]m<$P9}Uu$ BC]u}]Ð?t)PE9FD$7D$= <$3|5 "4$@]u}]붐t&UVS$; eE1^%\$L"ۅ\X "ۅ`Y"ۅdZ("ۅht[4"ۅlX@ "ۅpYL"$AX+5("i98$OEe3u İ[^];vU !$t$Ypqt!Zp!pt$t$]ÍUS  t[]Ë"Sd'$Í@w8"B$?$误K $h[]鵨t&$˻ H뺉US"B$>$Y t_j$Nh虿D$@D$ $@ y8$ h"$@ >[]Ív$g?D$@D$ $@ yާ묍US"P$[] UVS "B}E fEm]mux 譆9|"$ =4$蚆D$m D$D$ $ 5" $= [^]鵊t&US"B$=$"P$[]ÍUVS u  G$9tNu0ؚ,s#ق}E fEm]mMy!u$R9uق؂d]ق؂h]ق؂lU$]4$:  [^]t^떾늻냍t&US'%' '$Åuyؘ,sl!UHp d'ف؁d]ف؁h]ف؁l]$u$Mx: ʃu7"C[]Ë'$>''': "+d'Y[]ÍvU8d'u5"]}E~}F}] f]m]mN(] $:"EB4B@ uJ}\$E UMU\$D$ fMm\$ m$萌]u}]ÍvuE uu뛐t&Um%P"$ XÉ'U "QBuQ}E fE m]mEP$rnBm]mUR$r,Y"X "A Rs  ̐t&  U"JAuZtK}E fE m]mMQ$rZÍv ZÐt&ZÉ'UWVS,"Bd'$ $E]E !d'ApЉE䋘$ͷu䋎É $*8Y E39] 9uUZ :B 9t9V,[^_]Ë}iM<$X D$4$D$8E܉4$D$o4;(} M fMm]mEtE``^ t`^ ]؋>ôt!U؍t`^ |tM;-@A 7ôt!U؍t`^ |tM;7t!M؍t`^ TtU;"h t!U؍t`^ LtM;t!M؍t`^ TtU;BVt!U؍t`^ LtM;,t!M؍t`^ TtU;b8#t!U؍t`^ LtM;(t!M؍t`^ TtU;.t!U؍t`^ LtM;T4-Z :CW [ :KG\ :C7bM؍T};E܉$e~D$$D$5M܉$L$1}܉<$-~\$$D$辛xU D$$U܋xU T$$u] ug M䋱4$S4}Ë$@4U܉\$$ T$ D$Ey;[ :Z\ :BU܉$;}D$$D$4E܉$D$0U܉$|D$$D$i4E܉$D$J0U܉$|D$<$D$&4E܉<$D$0qM܉ $r|D$<$D$3E܉<$D$/;U܉$/|D$<$D$3E܉<$D$/M܉ ${D$<$D$]3E܉<$D$>/[!U܉${D$<$D$3E܉<$D$.M܉ $f{D$<$D$2E܉<$D$.{AU܉$#{D$<$D$2E܉<$D$u. M܉ $zD$<$D$Q2E܉<$D$2.'UWVS,"K d' $ "Z$9E܍G5!d'NpىM䋁$x}䋷É4$0Y E39m}9uUZ :ZB 9t9,[^_]}i״M܉]EEX L$ D$m  fEm]m$ut$p} ] f]m]mEtt`^ ``^ ލLôt`^ TtLt ;@A ?ôt`^ TtLt ;t`^ LtLt ;h t`^ LtLt ;t`^ LtLt ;FVt`^ LtLt ;,t`^ LtLt ;8#t`^ LtLt ;8(t`^ LtLt ;.t`^ LtLt ;T4UZ :C [ :Ks\ :CcT;M܋ED$m $L$ D$)nt&u] *ug M䋱4$-}Ë$-U܉\$$ T$ D$r[ :B\ :ZSU܋ED$m $T$ D$`m0WU܋ED$m $T$ D$/m4nM܋ED$m $L$ D$lKM܋ED$m $L$ D$lM܋ED$m $L$ D$l`M܋ED$m $L$ D$kl=M܋ED$m $L$ D$:lM܋ED$m $L$ D$ lRM܋ED$m $L$ D$k/M܋ED$m $L$ D$kUS"B}$E fEm]m];D$m $D$wf[]ÐU !D$ "T$L$$&.Ít&US$͵ QÉ$*\$$m D$o!Xpd'$ $&$ []ÍUS$]áH $+*\$$ D$7o!Bpd'$ $ d[]Í&'UV1S "!X+< <' D$D$$o\; Ѓt[; tJt=t0t"tt; tt; tl; td; t\; tT; tLCtC8 t>; t6x Xt-x Xt$x Xtx Xtx Xt x XuM"Hu"sU "Q [^]ÉD$D$$n\뛐UWVS"}BES "Y97QM1AÃBу9 t|vt`tGt.tZу9Bу9Zу9Bу9Zу9Bу9ts;utuBэR9t^BэZ9tQCٍZ9tDCٍZ9t7CٍZ 9t*CٍZ(9tCٍZ09t[89u[^_]Ã1[^_]ÐUWVS"}BES $"Y97QM1AÃBу9 t|vt`tGt.tZу9Bу9Zу9Bу9Zу9Bу9ts;utuBэR9t^BэZ9tQCٍZ9tDCٍZ9t7CٍZ 9t*CٍZ(9tCٍZ09t[89u[^_]Ã1[^_]ÐUSU+d'=4"x;`'| $( ؃[]ÍvUS]v\$$C n4"d'[]É'U$ ~D$;$\ }D$2$b }D$.$i |D$PP$' |D$@D$$CoUS "]A8StD$$D$o[]Í&U(UE w $ t&T$ D$ D$$@@ nɸ@@ D$t D$$@@ unۋ(" D$#D$m D$$@@ D$ D$[iD$$: D$["$> j "$: S  "<$uD$ 4$D$P"E]9XUD$D$$ T$ U[^_]t{t&'UWVS]$@$I \$ D$% D$$@? D$S$@? qR8)ƍ_D$D$ $@? Ft&tgtCtD$_D$ $@? eFD$D$ $@? FFD$D$ $@? 'FD$D$ $@? FD$D$ $@? ED$D$ $@? ED$D$ $@? ED$D$ $@? ED$D$ $@? gED$D$ $@? KED$D$ $@? /ED$D$ $@? ED$D$ $@? DD$D$ $@? DD$D$ $@? DD$D$ $@? D@? [^_]É\$ D$ D$$@? EQc&UWVS}"<$ L$$zËF$=\$|$ D$, D$$? D$P$? aO8)ƍ_D$D$ $? Ct&tgtCtD$_D$ $? UCD$D$ $? 6CD$D$ $? CD$D$ $? BD$D$ $? BD$D$ $? BD$D$ $? BD$D$ $? sBD$D$ $? WBD$D$ $? ;BD$D$ $? BD$D$ $? BD$D$ $? AD$D$ $? AD$D$ $? AD$D$ $? A? [^_]É|$ D$ D$$? 5Nc&US]$辆1ǃXCt,ǃǃ$'[h[]Í&'UVS=`'!!4$Ët#Ch rC' r095`'.t4`'4$3؉$[^]$ PG$< f>G$$j뭾!v뜍&'UW1V1S!']X|$؅=` {tD$` $` OƉ$t$f} M fMm]mUtgنm]mEupuv$5 TF4$4$$,T|$$` W[^_]á usنm]mUt4$_$$!+d'Bp+ ("i98$tB' نm]mEp$نm]mMB$H UUO|x]!Ít&)ЋC]Í ً]Í&US]+!x []Í <;019;trtat&tLt;t&t;;;;t~;tr;tfP9щ|i;tTB;tHB;tB $ >B+$ >|BI$ >tBg$ m>$ _> [^_]$ K>$ :>]$ )>$ >vUWVS}fAv{rff=sʃGfGfGfuE [^_]=$$m D$=҉ڋ $G L$f= $A E( +u$ 4=] tytctOt;t&t$ <]$ <$ <$ <$ <$ <$ < th$ y<$ m<$ a<$ U<$ I<$ =<$ 1<$ %< urf"G_$`\$$ D$;7w4$;$m D$;G&$$m D$;Gf$$m D$;GfW$ T$];&US$UM L$ T$eE1D$$Y=`"`| "$\$$ :$ Ee3u $[]Ð3?t&'UWVS  y)҉_5H""i?t&t~tQt(fK""H""K""H""K""H""K9"""K""^H""FK""^H""FK""^H""FK""^كH9""4݄B݀B5 [^_]$ B"$ ѹt&'UWVS `" ŀBńB!u^]}dU]5"JS}""W&tytat&tDt,tUBW OM؃A<:M؃A<:M؃A<:M؃A<:M؃A<:M؃A<:9]tlMAd';NKFC^_NOU؋Uu?u܉V^K="GS "tq{"DB .];E,[^_]Ë_$8N1L(Q$U{u\>]}] f]m]mEm]m}܋M!P$_}UE fEm]mum]m} V$#xU؋U|r>?1<! B|Zpd'ٛ$ؓٛ7sU\2]d'91v{MD9Ecz͉=("$mE(!Bptd'$$ T$$4 It&$x.v$ $?2؉ ;!}K5!}$ U^='Q$ @$ 릐UE ]ÉU]Ít&'UEP;d U]ÐU!S]M UUE # MM[]&UUE #EEm E ]>U8uEu }]#8}}܋X]UH҉M؋x ~{U܅tt]$0}$f.tMU}#u؉D$ ET$|$$0Mu]$d >]u}]Ëu됍t&$D =؉USMCiôX \ Y` Ad Y h Al Yfp Afr Yft A v Y$X w ؑt:فْd h ٚd l ٙ[]É] E []+v'UMABw ]i´ݘ`^ E ]J+v'USME ]#A#ډ$D$,U[]Í&'UWVSE}] HpBJi´X E싀\ .E!!4K M,Et$L$D$ E$uˉL$U$ K ];_t)1 D$}<$+uۋut$}<$tD$ D$]Ɖ\$E,$脁D$3$0'Аmt`^ }iUeܯ$0'T$讐M$0'L$u E0'[^_]t&U E [^_]z)[^_]ÉUS]\ X !+d'Ap t $`X K,ǃĿǂ0x  $D$D$Q/,$D$D$3/D$0'$0ǃ\ []Ít&'USMBw1ۉD$M܉ $~n D$ 4$T$D$w uĉt$u܉4$yLJDLJH<$D$0'>+]M!'Z|X 5!+d'ZpFp$s[$Z=!_p<[^_]m]m E)W$\$$ 謻 }M fM/D$B$ ~0 }M fMD$B$ R}E fE}<[^_] USUM ]BD$#B؉D$# ˉ$U[]Í&USUM ]BD$#B؉D$# ˉ$2U[]Í&USUM ]BD$#B؉D$# ˉ$ (U[]Í&US]U M#CȉD$#щ $!'U[]Í&'USUM ]BD$#B؉D$# ˉ$j%U[]Í&UWVSEueU1ҋ] }H0P H ҅u ȅuut#vEe3w[^_]Ðt&!!4#D$  D$J  ppL$T$D$<$%$%o$&Dž&X p\$D$  D$D$T D$4$1%pL$T$$!#(%=@t7$# P49w/<$T$\$$*&J4$d$y|#t&USEw9 t/t$#- ǃ[]Í'U =t$t#- t$R#- t$0#- t$#- t$"- t$"- t$"- t$"-  t$d"-   u)D$@D$$ #$ Nʍv'UHeI D$4D$0D$,D$(D$$} D$ UD$D$D$ fUm\$ mD$D$$  'm\$mFh(($V(PJv D$ D$T$$ \ ($lVd'(H $WV(!"B $ `$`tk`XD$W D$\$ pL$$T$ D$t\$${ (D$D$$ $D$D$<$Mt&UUE]ÐUME}UfUmmÉ'UME}UfUmmÉ'UUE] UUEB]ÍUUE] UUE] USUM ]BD$#B؉D$# ˉ$*$OU[] UEU H#@UL$$D$$aOUÍv'USEU ]#P#@ڍ T$ $D$$OU[]Í&'UEÐt&UUE #E]l@UE}}]] uEwuuE #]}]]] &'UuUu]] }U~$8}}E #^]u]]] &UUÍ&'U]7&U(UEJMBD$ D$EJ E$L$ÉUWVS}Me5u1U @G@#WD2W ɉHt ;\ OX p$V\$ D$m D$$ 4$ 9H} $ T$t$D!u H@} L$<$ ue35[^_]ÐQ wi ^ X L: u^ :Cu^ :S ޹ L ؉D$ D$A D$$ v\$$@ \t 8\$$`T \L $t$ |$$T$ (D$,D$ D$$ D$RC P ^ :Su"P^ :^u ^ :NP P trPB t^P tJP t6P t"P 󦾤 8h ^L$D$|$L$ \$B ޹uL$] uLC(L uLh ޹uLB v ޹uOL 8n$ D [ Q G = 3L\$,$Y&UXE}]u0X~w ~ ~ ]u}]$U$E9} E fEm]mM܅K\$(BD$$rt$ Z \$BD$riѴ$x lt$ij^ j^ \$j^ j^ D$ |$\$ËD \$<׍4P 4$dr\$D$$iôiִ$ 8X 8X L$|$kD$ $ SsUUE #EEm E ]7UVS`M eU1ҋU]# D$ D$@u$t$ ED$$EtJ$l`^ ; t t$$ $X8Ee3u`[^]Ðt&\$$ 07!'UUE #E] 8UWVS,uU M]FE~}#V `'F]F]1vd'\$$ uD$$'r]$'\$rE$'D$r|$$'trt$$'r}E U fUm\$m$'hrE'}E M fMm] m,[^_]6r] E{ ,[^_]0  UWVS E}] 04$ĠD$$'q#$|$'D$qن}] f]m\$m$'qن}M fMm\$m$'lqن}U fUm\$m$'Cq$'D$p$'|$r$'\$p$'L$r$'T$p$'D$_ru [^_]0UWVS ] #M M $$iд؉ǃt`^ K$2ƴt&tjtEt $8u >ƴ$ɞu >ƴ$詞u >oƴ$艞8jƴ$nZƴ$SQƴ{&<$(u >G$u W$u h G$ҝu W$贝u VtzG$蚝u ,t`W$耝u 8#tF_$f8u (t,Ơ.{u [^_]Ã>+E!E }E  [^_]Ã>߃>&̓>t&tÁƴvUU MBEJE$MHUÍt&UM$蝜$蕨UÍ&'UWVSE} U#x}='<`'t[^_]E``^ t`^ ]]``^ (6d t&@A %E``^ Uh ``^ gM ``^ EV``^ 5U,``^ M8# ``^ E(``^ 3U.``^ _MT4 ``^  Y:M``^ <$ D$ 4$D$]4$\$耾|$4$5;(<$Q D$$D$& xU D$ $kExU D$$m} =xU }[^_] j<$D$ $D$\M$L$ͽ|$$1?<$D$ $D$U$T$莽|$$<$mD$ $D$޿E$D$O|$$賻b<$.D$ $D$蟿U$T$|$$t<$D$ $D$`E$D$Ѽ|$$5Z<$D$ $D$!M$L$蒼|$$<$qD$ $D$U$T$S|$$跺8<$2D$ $D$裾E$D$|$$x<$D$ $D$dM$L$ջ|$$9<$D$ $t`^ D$!U$t`^ T$莻|$$t`^ 'UWVS,EMU ]@vUE U ,[^_]!ȉEEiU$X D$4$D$M4$L$`=;(}U fU m]mEE``^ t`^ ]ô>t&Mt`^ Tt};wt&@A >ôt!Mt`^ Tt};|t!Ut`^ LtM;[h t!Mt`^ TtU;t!Ut`^ LtM; Vt!Mt`^ TtU;,t!Ut`^ LtM;-8#t!Mt`^ TtU;(t!Ut`^ LtM;.t!Mt`^ TtU;WT4(,[^_]ËU|M;U$zD$$D$E$D$̶&E$=\$$D$  xU D$ $e}xU |$$dE$D$$D$OM$L$0KwE$D$$D$ M$L$AM $XD$<$D$ɹE<$D$誵f,U$D$<$D$膹E<$D$gM $D$<$D$CE<$D$$U$D$<$D$E<$D$b6M $LD$<$D$轸E<$D$螴U$ D$<$D$zE<$D$[VM $D$<$D$7E<$D$ U$D$<$D$E<$D$ճUVS]UsuCEK MSUsuCs$衑K MԋS$U؋K(M܋S,UȋK0M̋S4Mȍ]UЍUD$Eԉt$u\$1ۉL$ D$t$$MM1҃SQ!,$٘uR1V!,$ٛ M!u1RV!,$ٛ8EQP5!,$ٞ4U!M!u!U ! E5!$] !(U!,Uąt!+d'0e[^]Ív !ǁ0e[^]É'UStUEZ]JMB EZ]JMBZ$UM\$1ۉL$$D$ ԵD$ED$D$Ե"LM1SQ!,$ٚ]PS !1,$ٙ U!M1SQ!,$ٚ8]PS !,$ٙ4Uġ!]ȋ !U̡!]Ћ ! Uԡ!$]؋ !(Uܡ!,Ut !+d'0]Ë!ǂ0]Í&UVSpEu$蘎 M싐UUب]D$ED$L$ D$D$L$$J]tUt e[^]ËỦEЉMԉ$D$}Aك}U fUm]mEP$ٛM+ d'(e[^]ÉUS]$茍SKS CِCِCِؠ٘ؠ٘ ؠ٘E E[]@U]]u$s KS]E uE]T@t&UVS0]u$訌CCـ}M fMm]mEu0[^] Eɋ !E]]YpD$D$$輝5!^p0[^]Ív'UWVS]E #E$贋U }#S׍pC;5`']t&4$ȋÅuwؘtjكU؃ أ]ك؃أG]ك؃أG]$賳Es 95`'j][^_]+]!] } u>[^_]ÍvUME QU #EE]vUSU ]M#CȉE #щM[]雐t&'UUEuu ]}EZzхu;t]u}]Ív!# M $菅U}]}uUE ]UUM # M $臅EU !$t$YpqtB0!Zp!pt$t$]ÍUUE M]}uËr##Bˍ</$ tC$/t$<$D$ 8su]}]]O$C/t$<$D$ ]u}])'UVS u  G$9tNu0ؚ,s#ق}E fEm]mMy!u$貈9uق؂d]ق؂h]ق؂lU$]`$\  [^]t^떾늻냍t&UVS u'%' '$ Åuyؘ,sl!UHp d'ف؁d]ف؁h]ف؁l]$_$`x ʃud'$= [^]Ít&'$2'''2UVS u] $(VT$ N }M fMm\$ m#^]\$V$T$8 [^]ÐUWVS,u]M >VGUVv} ED ,[^_]!iߴUT$ D$m uX $t$}M fM m]mEt`^ ``^ ލLôt`^ TtLt ;@A |ôt`^ TtLt ;t`^ LtLt ;sh t`^ LtLt ;t`^ LtLt ;Vt`^ LtLt ;,t`^ LtLt ;18#t`^ LtLt ;(t`^ LtLt ;.t`^ LtLt ;T4U,[^_]ËT;;. MD$m L$ E$D$UD$m T$ E$D$tUD$m T$ E$D$C1MD$m L$ E$D$MD$m L$ E$D$MD$m L$ E$D$MD$m L$ E$D$\MD$m L$ E$D$NMD$m L$ E$D$gMD$m L$ E$D$D MD$m L$ E$D$UUM #JME m ME]UU$Et&UE$蝁UÍU ]] uu$* ND$` L$#]$?U1= ]u]Ít&US$eE1EU T$ D$D$$ `|8t1\$$ M$ mEe3u$[]ËHD $)v'US$]9d  $l BEMD$ U EL$T$$ E$[]Í&US$]9d  $ E UED$T$ D$$ E$[]ÉUSUC+iӴ!X !!!!!!!!!!!!!! ![]$ qUS !<d'$o~Í@v $ )iô[]X Ð&UEw$ $ 1$ع jɸ0'Ã=''t$( 'ɸp'ɸ'É'UE]upt$ou E]u]KND$É$脢t$$;(u]u]Ít&t`^ ieܯD$$L$ u xU UE]] u#X]t!$] E]u]Lt&K$4$D$¡\$4$;(u ]u]É$t`^ Jieܯ$L$D$] xU ot&UE]upt$u E]u]kMD$É$t$$(;(u]u]Ít&t`^ ieܯD$$L$)u xU U(E]upt$O]u uE]ND$É$dt$$;(u]u]Ít&t`^ ieܯD$$D$yuu}E] f]]m] m xU M]VLUE]upt$u E]u]KD$É$蔟t$$X;(u]u]Ít&t`^ ieܯD$$L$u xU UE]upt$u E]u]JfD$É$t$$X;(u]u]Ít&t`^ ieܯD$$L$u xU UE]upt$]u uE]LD$É$4t$$;(u]u]Ít&t`^ ieܯD$$D$I]u xU uM]?J UE]upt$_u E]u]ID$É$tt$$x ;(u]u]Ít&t`^ ieܯD$$T$u xU UWVS]} # M $wSUƉ#CEEtk^9`'~=$xƋu U#EtM$L$t9`'ŋ}[^_]+u!u>[^_]$ 6뇍t&UU M]]u#A4 t4$B ]u]t&#  $wPÃw)C$4$ a]u]v$˻ ɉUWVS,}]u Ew>#wiU ߻ ށX Uu ]C ,[^_]$˻ 7봋}x<$ $=uD$\$<$hD$ <$t<$D$ D$]$2|$U$ ;(}] f] m]mEnUt`^ E``^ ] tUtô@A -Uô2t!Mt`^ ttU;U䍳t!Ut`^ LtM;U䍳h t!Mt`^ TtU;=U䍳 t!Ut`^ LtM;MU䍳V t!Mt`^ TtU;U䍳, t!Ut`^ LtM;mU䍳8# t!Mt`^ TtU;U䍳( t!Ut`^ LtM; U䍳. t!Mt`^ TtU;T4M11Mt`^ Tu; E<$%D$ $D$薙|$$zt&,[^_]É<$D$U$t`^ ieܯL$d5xU D$ 4$^DxU |$$B$ !$ zM;"E<$FD$ $D$跘|$$蛔M<$D$ $D$q|$$UES<$D$ 4$D$1|$4$#E<$D$ 4$D$|$4$ՓE<$@D$ 4$D$豗|$4$蕓EC<$D$ 4$D$q|$4$UE<$D$ 4$D$1|$4$E<$D$ 4$D$|$4$ՒSE<$@D$ 4$D$豖|$4$蕒E<$D$ 4$D$q|$4$UsUWVSu}] $DpE#^`'1u`'t>\$$uV$]$PU쉂EZt;*t$[^_]V$]\$${ J$@HM8XPp xX@ ٙ@`ٙ @`ٙE M[^_]" ]at&'UUE #E]UEt8 wEM ]tt&]Í&'UWVS }='] ut $p 9#<;1ۉ<$`'-|$$g4s`'|$$? `'|$$^`'|$$^`'|$$^`'tq|$$t|^`'tS|$$t^^`'t5|$$ot@^} E  [^_]|$\$$ <`' [^_]Ít&'UWVS }='] ut $p #<;1ۉ<$`'*|$$s`'|$$`'|$$y^`'|$$S^`'|$$-^`'tn|$$ te^`'tP|$$tG^`'t2|$$t)^E!  [^_]Q<`' [^_]Ð Ut]É]juv' Ut]Ð]*~v'US]$1ǃXCtǃ$'[h[]Í&'US]4"D$SttD$$_[]Ít&'UVS`'!!t&4$xjÅt#@h r=' r*`'9t'`'4$)j؉$;[^]$ fB$i$n뻾!묐t&UVS utQ$%v8t+$at$$t $DuЃ1[^]ËC[^]tÃ[^]{ UWVS }u tB$"8t+$ t$$=t' $ uЃ 1[^_]à [^_]zC [^_]ÐUWVSL 1 !t`^ QpUAtEAt=!Gp``^ ߋtô@A Lt`^ LtH t`^ LtH  h t`^ LtH t`^ LtH Vt`^ TNH ?$ ( , 50 D$4 T$8 L$ t$$D$(T$, $t$D$T$ L$t$"X !+=d'{p D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$!UPp5!MNtL[^_]Ë$ ( , T$0 L$ 4 D$ 8 T$$L$(D$,$L$D$T$ L$D$$ ( , T$0 L$ 4 D$ 8 T$$L$(D$,$L$D$T$ L$D$o^H$ ( , T$0 L$ 4 D$ 8 T$$L$(D$,$L$D$T$ L$D$$ ( , D$0 L$ 4 T$ 8 D$$L$(T$,$L$T$D$ L$T$_8H 5$ ( , 0 t$54 T$8 D$ T(d L$$ X(d t$(5\(d T$,`(d $d(d L$ h(d t$T$ D$L$ȧXt&'U8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ÍvU8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ÍvU8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ÍvU8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ÍvU8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ÍvU8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$ $ÍvU8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$ $ÍvU8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ T$D$$Ít&U8 D$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ÍvU8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ T$D$ $Ít&U8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ T$D$$Ít&U8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ T$D$$Ít&U8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ T$D$$Ít&U8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ T$D$$Ít&UH }  'D$4UD$0D$,D$( fUD$$D$ D$D$D$D$D$ m\$mD$ $jÐ&U8 UD$4D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$$ Ív' UMt ts M]t1]Ít&]ʉË@D+P@ Ѕtݍ&US ]t t%r1t-[]Í][]3v۸ tۉ؃[]Å۸ tʋRDB ЅuB뷋J\$$@ L$ 뙐t&U$ ~a$ ra$ fa$( !t;  |nD$$\ D$`$b D$.$i D$$' D$0$ t& @ D$nP$\$$ ]_\$$ \FUS@LM9 @@C1҃; @trtatPt?t&t%t; @; @; @; @t~; @tr; @tfB9Éti; @tTP; @tHP; @t@C`S DsHk,K[^_]ÉT$ t$D$\ $$S t$$\ T${ 녍v{ D$ $|$D$8 $$kFSs C`#\f 0t&{ ka{C K`#\ЋKs S#`<2`Ks C#`<0`{C S#`4`Kل\؜`Wsل\؜`8dSل\؜`EKل\؜`&sل\؜`Sل\؜`K\;`S\;`K\;`hS\;`L{K\;`3bS\;`IK\;`0S\;`K\;`{ S\;`ߋK`K{ sCs`SS`kC|Cs 0{`{wS С ٭P۝L٭RL2$s<KCKS С ٭P۝L٭RL8D$ $Cل`٭Pۜ`٭Rsۄ`ٜ`SBل`،`ٜ`ClKyل`ش`ٜ`{IsNل`ؤ`ٜ`K&{Gل`؄`ٜ`CScs~`Ӭ`{CP`Ӽ`Ss~`Ӥ`{K`Sr`1`st{W` `SXs~`!`{< `+ `D$ $CT$$$8<҉T$$K`UHE MUuu}}EE ]]uu(}}$MM,UU0ۉE܋E4}؋}8uԋu$ cD$$ OD$P5$ ;D$pV$ '$  t ;  D$`[$ D$`[$ D$+$ ϶D$'$ 軶D$` $ 觶D$d$ 蓶D$d$ D$0F$ kD$$ WD$E$ CD$ $ /D$ $ D$$l D$$ D$$ ߵD$$ ˵D$$( 践D$P$5 裵D$[$J 菵D$p]$R {$ >$@ >ÐD$P$ L<&D$?$@  :D$ D$ D$H $@ 'USdeE1 8tI]D$ D$j D$@$\$$\F 5$Ee3u#d[]Í]ElistEip.cfEfgE豥'U$~dÍUd|u&$D$$ D$=$ 迠Í'UWVS1ۃ<$Y eE1莠t`^ t.݃t'd  ݃(d ؁ôt`^ ޅt.݃t'd  Y݆(d  ؁ô]}M fMm]mE܋j^ `^ D$ $o T$|$̟ ݃(d rLO}M fMm]mE܋j^ `^ D$ $ T$|$k ؐt&t`^ ݃t'd  wT}M fMm]mE܋j^ `^ D$ $o T$|$ ݃(d rL}M fMm]mE܋j^ `^ D$ $ T$|$茞 ؍h t`^ ݃t'd  wT}M fMm]mE܋j^ `^ D$ $o T$|$  ݃(d rL}M fMm]mE܋j^ `^ D$ $ T$|$謝 ؍t`^ ݃t'd  wTH}M fMm]mE܋j^ `^ D$ $o T$|$- ݃(d rL}M fMm]mE܋j^ `^ D$ $ T$|$̜ ؍V#t`^ ݃t'd  wX1Ҟt}U fUm]mU؋j^ `^ T$ $o t$L$= ݃(d rP1Ҟt}U fUm]mU؋j^ `^ T$ $ L$|$؛؉t`^ Z݆t'd  1$  11ۍ}t&D$D$ <$译݃ 1t!}% U fUm]mU  T$ t$L$ D$T$|$L$ $@ Ú95 ~H  MD$D$ <$QD$D$ <$4Ee3<[^_]114111T11F1j^ `^ D$ $ T$|$ٙ1j^ `^ D$ $o T$|$蝙 g1j^ `^ D$ $ T$|$]u51j^ `^ D$ $o |$t$% }U fUm]mE}M fMm]mE\}M fMm]mE}M fMm]mE &U]uot.ett$ b$ V]u]Ëd t2 l L$ h T$$h D$]u]Ðt&$ u$$$؛$$›$~&~"~ /d 5h l =v$L 脗]u]$t n'UVS``^ $E$mƸt`^ t`^ Lt ;tYt`^ Lt ;t<=@A t`^ ȃ|t ;tt`^ |t ;th t`^ |t ;tt`^ |t ;tVt`^ |t ;t,t`^ |t ;t8#t`^ |t;tth(t`^ |t;ttO.t`^ |t;tt6T4t`^ Lt$$ Ε1[^]ã  X 4 [^]É'US u$ 胕[]t$h$Z$肗 AHu$L t${Ee3u[^_]$ XٔUS1ۃôt`^ v|`^ t`^ v|`^ h t`^ v|`^ t`^ v|`^ Vt`^ v|`^ ,t`^ v|`^ 8#t`^ v|`^ (t.t`^ |`^  `^ $>[]Ë`^ $%`^ $`^ $`^ $`^ $%`^ $/`^ $9&'U腒t$1 脎É$t$蜐$dÉUSDt:t5$] 9[]ÍvD$  $H []Í$D$^, $t$p []D$/$uD$\$uD$:$u$ED$ \$D$ $@ :vUSTtJtE$ I[]ÍvD$ $@ $v D$[]Í$D$^, $t$ []D$/$uD$\$uD$:$uD$ \$D$ $@ 2t&'UUt$ TÉt  ,$Ðt&UVSt/ tht&$ [^]$ $`T wD$$`T $ D$賋[^]$蠏$`T D$p8*$y$ D$i[^]É$T8*$?$`T D$$!$D$ \$$`T D$D"!'X| !Ap"$轎$bG"4$RG5"$苎$`T (D$X$ GD"$`Ue$O\$$ D$;[^]$ (-vU]]u'u u ]u]D$4$0'\$$0'']u uE0'] U(]u}茍t7肍t$@ n]u}]Ð$ T$@ @ D$!‰%t @ L$$ $$@ D$8$nj$ D$跈D$褌$薌>*ttD$D$ t$$@ 4$t@uT|$4$2+$4\$$ D$ $ C|$$8K딉UWVS,   eE1fD$D$$耋袋8"v``^ D$މ\$<$D$D$ <$t`^ 0``^  (6d @A 0``^ .h 0``^ 0``^ V0``^ ,0``^ Z8#0``^ %(0``^ .0``^ T40``^ Y:3``^ ,|$ D$m D$$ 5;(l|$$m 蝰|$D$$MEe3,[^_]É|$ D$m D$$nY|$ D$m D$$M$|$ D$m D$$,|$ D$m D$$ |$ D$m D$$|$ D$m D$$P|$ D$m D$$|$ D$m D$$|$ D$m D$$f!‰%t te)qt$D$$MxU D$$G xU D$ $1xU |$$ 듉|$ D$m D$$~$.Duo&U(D$ ]u}$@ E$bD$ $@ ]{lj$D$ $@ [D$ $@ EE r*;;t :t&u,D$+$l 誔E؞u$ 蒔]u}]Ðt&tދU|$$ T$eэvUWVSLED$ D$ D$" $菶uEE>t4$†D0>L}À>tuԋuučuȉ4$D$ D$ D$+ }ȋM̋UЋEԉ}؉M܃ۉUEt ?}Mu$A уMt$赃D$ D$ $`T ƉD$SD"}t]u|$$A \D$ D$ $`T ƉD$D"?}e[^_]á!'X| !Ap"4$=U"$="t$$`T ($=5D"4$Kwt$$A 节D$ D$ $`T ƉD$(D"uS5|$$A ?D$ D$ $`T ƉD$D"s !'Y|!Bp"4$<E"$<"t$$`T ($< D" $J2}/}D$$A l$`T D$iD$@t$$݃?;]tBD$$A $`T D$D$@t$$y\$$A ǀ$`T D$D$@t$$;\$$A 舀$`T D$D$@t$$tb;]}$A |$AD$ t$$`T ljD$|$$`T #D"҉E%EL>}4$ED0>?L>ϋM$A L$D$ t$$`T ljD$P|$$`T D"҉EE!'X| !Ap="4$:U"$:="t$$`T ($9D"$"Hh!'Z|!@p="4$9M" $9="t$$`T ($h9D"$GG\$$A c~$`T D$cD$@t$$׀9{|$$A $~$`T D$$D$@t$$蘀CD$$A }$`T D$D$@t$$YST$$A }$`T D$D$@t$$|;] !'Y|!Bp"<$8E"$ 8"|$$`T ($7D"$#FE !'Y|!Bp"<$7E"$}7"|$$`T ($W7D"$E`US$]$~D$D$EE$8}t؃$[]ÉUW1VS$ , t1 }U fU 4 m]m}< L P X T $\ \$` T$ 5]ݝ(ٝL$D$\${^t$|$ $< E\$}D$݅( M fMm\$mمm\$mIyD$Թ'$ 5y $8 y$ y$ x$\ xt`^ E``^ t`^ ]̋ű\>t`^ Ǵ3@A ÚǴt`^ }]D ǴE̍t`^ ]tt4$L$T$D$ \$t$\} EM fMm]mUT M̋EE TuE ŰMD $A D$y$']̋uE3D ف0}<$E fEm]m U܋]uMT$U\$]̉t$L$ D$d $ D$^wu3 ]̋E< kLdƉ3H$ D$Ru@A Ts(ߍ < TDs(<ztI.<(4<V9<?<2DE<uK<KQ<|`!W<T4s(<*Tؚ D$ \$ق0x}D$T$M$  fMm\$ muT$ u[^_]Ë=!$ aut`^ E``^ t`^ ]ȋEȋ\8 t`^ Ǵ0@A uȁǴt`^ }TEǴ]ȍt`^ D3t$D$L$T$ \$D$?Y} EM fMm]mU]ȋUȋL3Mԋ2D ـ0m]m<$]ċMԋUЉ\$]ȉL$T$ D$3d $e D$'t3Q]ȸ L3u $sMȋ1<\k1Ld1H$ D$r4$T$D$L$ t$T$X} EE fEm]mM\EȋMȋTEUD ن0m]m$UMuT$UȉL$t$ D$d $e D$rMȀMȸ tt $rMȋ<tSMkLdH$ D$pMȋD1$ lr7D$ Hr=TwؚfD$ , D$ق0}L$D$U$  fUm\$ mqtI.<T ؚD$ , D$ق0}D$t$M$  fMm\$ mTq(4<TؚD$ t$ق0}D$T$M$  fMm\$ mp9<<T-ؚD$ t$ق0V}D$T$M$  fMm\$ mRp?<TؚD$ t$ق0H,}D$T$M$  fMm\$ moDE<`TQؚ@D$ t$ق0#}D$T$M$  fMm\$ mPouK<TؚD$ t$ق0(}D$T$M$  fMm\$ mnKQ<TuؚdD$ t$ق0d.}D$T$M$  fMm\$ mNn`!W<TؚD$ t$ق04}D$T$M$  fMm\$ mm$D$ \$$L$ (T$,D$R$~ D$xmZMĉ $}EU fUU $t$ D$$L$ (t$,D$Q$~ D$mE$`}EU fUZ$ ld$ l$L$t$T$ \$D$P} lM fMm]muű]Džh Tt Džh MűD$A D$m$]̋UdD Eن0}$M fMm۝`m)lhd`T$Ủt$uD$L$ \$2d $ \$pkE̋M$ŰM <tbű]kLdH$ D$ai]̋MD E<$ j+D Ev9$ j(]܉$E4$T$ L$$D$ (\$,t$N$ D$Vjl$lU $D$ \$$t$ (L$,D$N$ D$i$ iTؚD$ t$ق0}D$D$8I.U$  fUm\$ mciq$ RiE5T(d X(d \(d `(d 4$d(d 5h(d \$L$T$ D$t$M} E] f]m]mMUȋ]ȋ:D t;ـ0m]m$t`^ &M]Uȉt$L$\$ D$:d $e L$hEȀ8%Mȸ t9t $XhEȋ8<uk>Ld>H$ D$_f$ hK$ ggT(d \(d X(d `(d $5d(d h(d T$D$L$ t$\$IL} |E fEm]mUMDžx t9t Džx ]̋T;$A T$&i$M̉t9D ن0}$t`^ E fEm۝pm|xtp\$]̉T$L$t$ D$;d $ D$fÙ:E̋8<]k;Ld;H$ D$dD8lc$ Uf 5d 55d 5d 5d $5d 5d t$T$D$ \$L$J$~ D$fE$a}E] f]t`^ ``^ ߍt`^ $ eDWt`^ T7@A t`^ uDtŋ $D$T$L$ D$T$Id P} E fEm]mM$PT$ D$LL$D ـ0m\$m$3 d<kLdH$H D$bDžL Tt DžL DžH ۄ Eۄ$ݝ8LL$H݅8L$\$ D$ل} $P ] f]m\$mc1$ c $D$T$L$ D$T$ H7d M} E fEm]mMdM؉T$ L$D7D$7D ف0m\$m$3 'c7<k7Ld7H$H D$4aE L7uE E 7ۄ7 ۄ7$ݝ8MUL$T$݅8D$\$ ل7} $P E fEm\$mYbD7MD$ ,bDu$ aG$a}E fE$E}M fM $T$ D$$L$ (T$,D$FEU$L$ D$$L$ (D$,L$EHD8MD$ a3$ `55d 5d 5d 5d 4$5d 55d \$T$D$ L$t$Tݝ ݅ ؞ ݅ wCE$PX$a D$@TEe3 [^_] ݝ t`^ ``^  ٍt`^ ܍ | t ;\F(6d t`^ |t ;\)@A \t`^ ֋|t ;\t`^ |t ;\h t`^ |t ;\t`^ |t ;\Vt`^ |t ;\,t`^ |t;\tk8#t`^ |t;\tQ(t`^ |t;\t7.t`^ |t;\tT4t`^ |ݞEU,M!ډ%t uN+<$)V\$D$E$>S9,79uE݅ ؞} t E݅ D$\$ T$x D$ $|$G }t E݅ 8D$\$ T$D$ D$d$Vً!‰%t u)ٍQT$D$4$ \$4$$8 Px D$ $L$GM!‰%t uO+UD$ )ˉ\$$Q9n 3Tt&'U8]u}T5$ TD$/D$\É$趩u\$$ O]u}]D$ $Suπ;/tʉ$vS~6 :BJu$ :Qu :Au  :Qt ^, : u_, :Cu`, :S]\$$ 9O\$]$m PD$ D$ $D$u>u$$ N$ NR >L;t)|$$RtKHt\$$ Nπ>tz ]"D$t$$ fNL>tV|$4$tRtFHuF@=~P$Eɉt$$ \$ \$ N ]EEɋ}$ |$\$ \$M$QU u$ MÍv;t4 ق u0ǂ@@D$ D$  $HÍǂAD$ D$  $XHÍU u$ MÍv蛵t 4 ف}U fUm]mE@P$ٙ4 قm]mE@t&D$/ D$  $GÍ&D$" D$  $GUWVS| eE1ED$OD$U$RPEQ$``^ t`^ P$(NUكU6\/(6d ٍt`^ \t ;D@A ۉ΍t`^ |t ;Dt`^ |t ;Dh t`^ |t ;Dt`^ |t ;DVt`^ |t;Dty,t`^ |t;Dt`8#t`^ |t;DtG(t`^ |t;Dt..t`^ |t;DtT4;D}UU'D$PD$S $@}$+]]NMD$LӃ $D$C}}~.tbt2$]ND$L$D$B}<$MUD$L$D$B9}<$]MD$L$D$ZB9}9}t&_$pMUD$L$D$B9]_$EMD$LD$E$A9]_$MMD$L $D$A9]C9}tH<$LMD$L $D$A9}OED$LD$ $oA/M9!%t u+MEU>]T$ x D$V $D$>M>L$ D$ D$4$KC\$$g ID$4$D$4$eEe3(|[^_]ÉD$$o G$; GȍED$LD$ $\@UD$LD$ $<@RMD$LD$  $@UD$PD$$r $?}D$LD$ <$?ED$LD$ $?ED$LD$ $?FMD$LD$  $|?:KUWVS]eE1}~JE3U .|$D$ x D$ $L$<3|$D$ D$ D$$NA$D$ L$$t$ (T$,D$`* }"|$x $ |$vG0D$D$p4$ t$ D$$D$*$bcEe3 [^_]Í&|$D$  x D$ $T$f;3|$D$  D$ D$$ @ It$H$I@~t2}t$ D$9? D$P<$x v $t$T$D$ L$t$( {HUWVS "H+$``^ 1Hۉ$9F$pDD$<$D$9D$D$ <$99D$ $ AD$<$D$8<$BD$ $ Fu?t$ D$D$$6C\$$m Ƅ?4$@t4$D$ ruEe3uK,[^_]D$ $2 U?$ G?$) 9?$ +?Ct&U8]u}B$ >]u}]$ B$BD$/D$\$ErED$/D$\$Wu$L >D$ $Buހ;/tًUD$/$?u‹}܉<$|B~tt1L>tOFHuU4$T$nAtމt$\$$W >$6put$$^ =멅t|$$n <$ <vU(]u}@t$ <]u}]$ @$E@Eu$ t<빉ED$ $@uًU:/tы]$~@u}<$n@vt}$ |$;u$ t$~;'U]u}L?t$ K;]u}]$ -?D$/D$\É$єu$L :D$ $?uހ;/tى$mu\$$h :t\$$ :_v'USeE1E uEe3p[]Í\ L$$ \$/?;(_$ m/]ٽZ Z fX٭X۝T٭ZTug$=D$ $?$@ ى\$蜭$> .v=v$ n9`$`dhlD$p\$tL$T$\$D$ D$@ $ : ɉt%D D$Ѝ P $W\$D$$u^t&$t&<D$@$@ D$.D$ @ D$ D$@$ =\D$$  \t0$?= D$ $ bD$ $ 7yÍUWVS,D$  $ 9UD$ D$ $D$tk];u$ }7e[^_]Ðt&[; H :|$D$  $ 67$ *7;1EEE9)1\$D$$J 6  :t S@U܃EEL;to|$$C}tD$ $:)؃\$D$$A 6D$  $% |6AEEE$ T6$ H6 :u;E \$}$D |$6e[^_]$ :E \$u$ t$5U8$]u}9¡h`^ )ÁQE}عų  )񾉈i)Ӊ)ڻ ~t  ~H \$T$D$ L$|$$h 05]u}]ÍvE.‰D$R <$4)Ɖt$;~!<$9fs Bi΀Q).<$8f ㍶'UWVSk]eE1 t$9M ǃ }U}KkE1ۍp\v @ s\t$D$ L$  D$<$L$ D$9<$l@ \\$D$ D$  D$<$D$ L$A9<$k @ ^\\$D$ L$  D$<$L$ D$8<$]kt[^tP\ @ \$ T$ D$D$ L$D$<$8<$kU uM1Ƀ@ kuS !ʉT$ D$\$ D$ L$D$<$18ku|$$  \${2D$ <$9 O}}$ Lٽbb f`٭` ٭bok}1p V T$D$Y L$ D$D$$c7$i V T$D$Y L$ D$D$$7$i V T$D$Y L$ D$D$$6$KitP  t$D$Y L$T$ D$$6$hD$rC $~7 ku\$$  |$0dž Ee3ļ[^_]Ë $m D$o0ǃ $ gٽbb f`٭` ٭b$e !0k]ǃ n$ 0dž Sv4&'UD$$Ít&UD$$Ít&UD$$Ít&UD$$Ít&UD$$Ít&UD$$vÍt&UD$$VÍt&US]$ jZ$ . ][]`U$ÍU$ÐUEM  U@@@ P]ÍvUWVS=xU UGOE~61 9UL ~)A:T u];Yuyu܉WxU J>uAAqxU B xU CC= G 5xU N[^_]ÍvUSXډك _ƀ _Bv BЃ vȃS уAv AЃ EЃ S BЃ 8_S уAVAЃ J_t& SуAAЃ  _t& SуAAЃ _t& SуAAЃ _t& SуAvjAЃ vb_ SуAv Yй_ wуZ ډكBȃvЃ뜉ЃoЃ5t&ЃЃ 0C2 0 13 1 24 2 35 3 46 4 57 5 68 6 79 7 8: 8 9; 9 :< : aa a bb bYA S    YC  AP  AX  YS  YC  AP [  g ( (= ( ) )? )N .< ./ .. .% .Ζ . . . . . !A !Ö #C #Ŗ %E %Ɩ &F &ǖ 'G 'Ȗ (H (ɖ )I )˖ +K +͖ -M -[] @` @ [{ [ ]} ] [0 [ ]1 ] { { } }ø__t&'U‰VSu[ ^] Ⱦ  J  )Ӄ3- =!>_: tQt&>_G >_3 렉 >_ VֈYلtk:_ rJCKtGz_ rKBCt"z_ rJKPF [^]€ _^€ _ _Zt& _i _ _ _X눍U1҉SËj^ 8t|`^ u  j^ 8t|`^ uj^ 8t|`^ u h j^ 8t|`^ u j^ 8t|`^ utwVj^ 8t|`^ utW,j^ 8t|`^ ut78#j^ 8t|`^ ut( []Í&'U$ $ $ $` $ $` $ $ $` $ $ $` $ ~$ r$ f$ Z$ t  9Z$H lVD$$A W&$ D$D$@$  ĕ ȕ ̕ Е ԕ ؕ ܕ          6D$@$ 6D$$ 6D$$ 6D$$ 6D$`$cE 6D$@$" |6D$@$) h6D$`$4 T6D$@$= @6D$@$G ,6D$$U 6D$0$\ 6D$P$f 5D$|$m 5D$p{$y 5D$$ 5$ $ $` á@ L $m$ =~ D$$ "vUW1Vj^ S1ۃEEôj^ ƴ8t|`^ 5j^ 8t|`^ +h j^ h 8t|`^ !j^ 8t|`^ Vj^ V8t|`^  ,j^ ,8t|`^ 8#j^ 8#8t|`^ (( t8j^ 8|`^ U4$T$Q"UE[^_]ËU4$T$+"UU $T$"UU $T$!UU $T$!UU $T$!UU $T$!UU $T$!Ut&U8]á E)EۋUu} t`^ ``^ ލ Ed ?t DuUE j^ 1ۉ}썹t`^ d 9t DEۉEUсt`^ d 8t D^Mt`^ d 8t0|u(UEҍ0ME<  Mh t`^ d 8t0|u(UEҍ ME< Mt`^ d 8t0|u(UEҍME< tiMVt`^ d 8t0|u(UEҍLahME< U܃ۉUt}DŽ,t |Et`^ Ǵt`^ d >t L1E(6d d >t T6h @A Et`^ u䋴d >t Da]E(6d d >t |]E j d >t T]EÐo d >t L;]EDu d >t D]E{ d >t |}8#Et`^ d >DU荏| L$$E~&D$D$ $  Ud D$t$$  E@A  [^_]Í0}T$<$:M~&D$D$ $ ' Ed D$t$$  E4MU0L$$8E~&D$D$ $ }d D$t$$ EEM D$ $_}~&D$D$ $ LUd D$t$$ *E}Eǘ|$$U~&D$D$ $ Md D$t$$ EWU}LaT$<$[M~&D$D$ $ pEd D$t$$ NE MU7L$$E~&D$D$ $ }d D$t$$ EM荇0D$ $U~&D$D$ $ Md D$t$$ uE_Mt`^ | D$ $;U~&D$D$ $ (}d D$t$$ EEt`^ 0T$$M~&D$D$ $ Ed D$t$$ E_'UVS0} U fUm]mEu e[^]ád uD$  $W D$9D$ D$ 4$D$-@} ] f]m]mM 9M~0 m]mu~]t$$6  }0 M fMm]mUuDED$ BD$L$D$ ;SHt$L;u$  1 d \$ D$  $T L$# $[>뭉'U$]up@ǀ$D$M $:؋u]]Í&'UWj^ VS eE1X$DžHDž4Dž8Dž@t`^ Dž0j^ 0HǴ0@H @:uNjJu4X848<$T$X w8 thtEt&t<$L$4 f<$\$ <$T$ <$D$ <$L$ <$\$ }<$T$ _98<$T$U 5<$D$: <$L$ <$\$ <$T$ <$D$ <$L$ <$\$ x98088EٽR0 Xp RD$Թ'\$ D$$  fP٭P\$٭RD$, $ ٭P\$٭Rp ٭P\$٭R 4ٽRp R fP٭P۝L٭RLX2!%tကu+,XD$ )Ӎ  $\$ D$ D$$  41XX!%tကuĿ+,L$x )щL$D$ D$ X  $m $  ĿT$x D$ ) T$L$ $0 ;4A$  D$ Թ'D$ ) T$$ Xt$Y& Bu t 1   u⍵XD$t$$  Ue3R [^_]D$ D$$ < 8DžDDX!%tကuD+,XL$ )Ѝ4|$D$ D$4$ $ B|$ D$ ) L$$~ 4Dž<1;4X|$| $JuԍX!%tကuĿ+,L$x )щL$D$ D$ X  $$ XĿT$x D$ ) T$L$ $Ŀ<;4$   L$ %wuP`^ tĿuۅĿٕ $J \$ ٽҿҿ fп٭пە̿٭ҿ̿u؍e[^_]Ëd إ s\$$c [e[^_]Ë]u<$E\$ t$$ D$-$YU$ÍU$ÍUVSÁeE1t$C t$Cu&$Ee3İ[^]Ít&StCPT$D$D$  D$T D$4$4$4$!%tကu))ЍLD$D$  $F4$#C$y1>UWVS5'eE1t?ٽ2 2 f0٭0۝,٭2,u>& t$ Me3 [^_]Ë 5  FDH|$DžDD$4$tٽ20 2 f0٭0۝,٭2,~/P`^ t%1ɍ1zu9H]ȉ\$ $UȋM؋űEЉ$]ԋU܉L$t$D$T$\$ $P ƉD$$X(xǁD$@t$<$M<$ >$$(1 >+$Ƹ]AL)k^ )މӍN! J$?Otht9nø]AL)k^ )C!ӈB $ 5Ǹ]AL)k^)ύW! Ǹ]AL)k^)׍O! ?t&Ǹ]AL)k^)׍O! Ǹ]AL)k^)׍O!KǸ]AL)k^)׍O!KbǸ]AL)k^)׍O!K?^T`^ (T=T`^ 9 D$ D$xD$ <$<$n}ffEEfEDž@D$D$$n@|$D$!T4$t`MD$L$4$ t)D$4$85 4$t& 4$gÉ$+D$$ D$l;É $D$$t T$a!Uuu]}uEE]u}]Ív>t4${D$Et4>ME}ËB u \u돉US  xU A+BA xU Z\$BD$$>  xU PxU SQxU @Q;Q xU }A)CC []ËA)CC []Í&'U(]ˉu։}Nju,At=r-w ;~B1]u}]$x Q D$t$<$T$ t$|$$ UWVSu~Q}~HP`^ ƒ )ƅۈUEEEEEtȃ{tu[^_]Éٺڍ&UWVS P`^ }u u5t&t&`Qt9uىuލt& [^_]ÍU8Eء;(]ӉuΉ} m}U  fUm]mEP$=  1҃~}UD$<$9U U 5U wED$<$E؍MX $D$]}؋WT$w4$$]u}]øXt&}&K \$$| {뾃uED$<$@U MD$ $]$G;5U  ED$<$"ED$<$ UWVS< xU QA xU AE_Q9t)эD: L$T$$, xU )q xU qxU )u)p  r xU u;q}0\; {Uw uЅt9Eu܋U 9Stu;q|ԍt&  A;A t0<[^_]ÍK EME}K$M xU ?;AtQAQ <[^_]A9xU {׍t&UWVS,;(eE1MB[ Dž +[ 9ȉ 8 B[ ?i [ ݇ 5xU ݝwLDž$DžDž(] #t&L( [V;[ u݅f݅v{ [ 9ʉ}h׃?iǤ kLES0uMCEuFuA݀ c(݅؍Q;}Ӄ?iä [ 8K,9t؋N4F8V<^(~ĉ,Nȉ0~^tN ~[ k,ه] م4ٕtم8ٕtم<ٕtVu&xU ~[ ^] tTxU م(ف] ؜9dtم,؜9htم0؜9lt ډN;:xtF;:|t@V;9ttˀF;9pt$D$*I$L$I$\$HN$L$yIt& $ t&7Od@yF9XFV9dFЉ9\Vċ^9tFԉ9hV؉9`^ȉ9x9|9l^̉9pم\$$`H م\$ $?H م\$$H($L$G,$T$|G 0 $D$[GNԍ$L$GVЍ$T$G@F؍ $D$GrV̍$T$tGX݅C F w ٝ(Fٝ4CF w ٝ,CFٝ8CF r% ٝ0CFٝ]u}]$É$u;0u$蹿=;(d pt$D$  D$T D$D$<$<$f u/t$$ B :uA$8 6t$$$ ̾st&e d  T$ L$t$ $ $p y$ "v'UWVSeE1dt$$ cEe3~e[^_]$?8*$u'0D$@4$D$}D$+ 4$ d t$D$  D$T D$D$<$h;(uX<$ u:t$$s  :t$ $&t$$$ pӉ't떍xd  D$  $W D$ \$D$ $D$  ;0DžUt&d \$D$  D$T T$D$4$Z4$ tK菺$ L;tM|$$t ;(t>t5t&{\$$> [뜋t$N |$2$` ! d  T$ L$t$ $ $ :XUVS P`^ ut?P`^ tg؉P`^ 1P`^ uD$$ [^]Í1҉tԋuۉˋCr{uytouiD$ D$L$C$D)ȉD$ D$$L$ }p M fMm}mE2 9#C $p벋;~IC T$D$D$ $;}K $ ǃUM8 6t&'t&'U(uƉ];(tVu ]u]Í]E$D$qE$D$]VEUD$$D^\$N $2$v]u]ÍUWVS 5P`^ eU1ҋE)'U `QF;(U DžDžDž$Dž D$ $@ x8 D$ <$m9D$<$]85l`^ <$t$K8\$<$7<$'\$7 d'$ <$D$m7$ <$D$75$ <$t$7$ <$\$7 $ <$L$7$ <$T$7$ <$D$s75$ <$t$a7$ <$\$O7 $ <$L$=7$$ <$T$+7D$ <$K8D$<$;8D$ <$+8D$@ $ <$D$k6?<$D$.<$7D$<$7d'Dž1d'D$<$5$~D$<$7t$<$s7<$5D$.<$E7t$<$97d'z$n D$-<$7D$<$6d'1d'D$<$'5$~D$<$6t$<$6<$^D$-<$n6t$<$b6d'z$N '~1Dž'2vT$<$T$'495'>'$=~<$ '1D$ ^<$5t$<$5`'<$T$3D$ <$j5\$<$^5`'^<$D$3D$ <$85\$<$,5 `'^<$L$v3D$ <$5\$<$4`'^<$T$D3D$ <$4\$<$4`'^<$D$3D$ <$4\$<$4 `'^<$L$2D$ <$p4\$<$d4`'^<$T$2D$ <$;4\$<$/4`'<$D$|2@g<$D$ 4<$D$ S2&=;(`QUe3_ [^_]Á$D$ <$3l`^ $ D$^<$D$1$!Dž``^ 1Džt`^  D$<$3t$<$3t`^ <$L$)2D$$<$2t$<$2$?h<$D$1D$5<$2t$<$2L<$L$2D$%<$q2t$<$e2 ܤd<$\$1 $D$,D$$D$_"D$(<$1t$<$1L<$L$0T$<$'0$w<$y NDž Dž  t`^ j^ uك,ك 0ɞ4ʋ8 كٕٝ<كٕ( ,ٝ(0j^ t$(,0ٕ0؞D$*<$S0 <$L$A0t$<$u/كٽ<$ f٭\$٭0vt&t&j t&Ct&@uyu9$<$0ك<ٽ<$ f٭\$٭/كٽ<$ f٭\$٭.Nكٽ<$ f٭\$٭. Ctٽ<$ f٭\$٭l.0<$T$-,<$D$-(<$L$-Xم\$<$-18<$T$- 4<$D$-ٝ(,i] EE@ƅED$4$ƅED$4$xDž@D$$^Dž@D$$D$kp<$G<$ND$<$,D$<$,<$iD$<$,D$<$,<$JIv'USÃ1t;$u;(t,P`^ 9P`^ $[]D$D$$xU \Q1ҍA8i[ @Li[ `i[ ti[ Hi[ i[ `$i[ i[  uD$HqD$] $xU D$[ $/P`^ xU xU xU 9$[]Í&UWVS,eE1~$$ Ee3e[^_]t11Ƀ>j^ :j^ ;h j^ ?j^ 8wVj^ ;S,j^ ?/8#j^ 8 (j^ ;.Lٽp  f٭۝٭~  Et$D$ Թ'D$ D$@$&E= 萙u$ |$ $D$ D$*4$D$@D$趸M$L$$D$虸d D$  $W \$$#<${ t$$ D$ d D$  $W L$$D$ |$D$z4$U$$T$ xD$D$ D$$4$S D$$ L$d D$  $W T$\$D$ D$$ 4$5d $D$ $D$  $# t$5D$<$D$$־[|`^ .m|`^ |`^ |`^ |`^ z|`^ V|`^ 2|`^ ؟}萝øğ\$D$ D$@<$D$ ٽ  f٭۝٭YDǸHƸ<'ø+D$Թ'|$t$ \$$ D$UD$@D$$耷-Ƹ՗MD$Թ't$D$ D$@ $D$ $iD$@D$E$´søgD$ Թ'\$$ D$?U8eE1]u}t)$0 ݽEe3L]u}]Ã='t$C 諽t5 ]$蔔 t$ $ L$D$6$D$<D$³d D$  $W T$$Ld \$D$  D$T D$D$$ً9!%t tȃ)؃R]t+ tD$D$+ $CUP`^ ]UWVS$D@eE1aP`^ DžH^pDžLP`^ ~,<P)ƉPt$|$$G&=8 t8 +CL)‰LT$D$ $豲HLD7ud :dLJH tS Ht@1sNG$D$ 赲\$D$s4$謴D$$ D$ D$ D$$` aDž ` ǹ` D$$L  z9{1 HuJtF  T HMkkv Q$  1 '\$$J1ȸH(D$<$ D$ D$ D$$` 萰` o Ǿ` 8N :` u3 :a u$ :b u :c  D$` $ *T$D$ D$t$ $ ىT$!‰%t u)ىL$$zT$L$$D$ t$D$ ȱ\$<$茬ډH1jD$ D$D$ H $C1Q,Fi4$ 6ً9!%t u)ىL$\$4$7=d <$K4$|$D$7D$ D$ D$$9ø1H\$|$LH4 $D$ 训\$D$P$襯D$ <$y|$D$N $pD$ D$D$ ^$MB p fUWVSEU MEUE=~=E bG^G ^ ˍYtG^tG^tG^tG^tW(;V(tO,;N,tG$;F$t U1E@&O09t G ;F t=fEtME%EtˀtπG@t@UJ(;J ~n^_NOV W FG^_NOVWF G ^$_$N(O(V,W,F0G0^4_4[^_]Ít&V07&7&27ف @t$E$! f!}6vJ axt& t&t& _}] }[^_]Ma=E@=E`|$ `(E`dt&$" D(U[^_]ӉT$u4$ ED$M $ }vUΉL$u4${ w t$E$]  t&W$T$M $> t&w(t$E$ {t&W,T$M $  dt&w0t$E$ Mt&WT$M $ ;t&wt$E$> $t&W T$M $N  t&wt$E$ t&WT$M $ $6  8&US]U EM] ]][]0UWVSU}$@x |X E]1ۅO t&ôt`^ t`^ Bh t`^ t`^ Vt`^ /,t`^ ~8#t`^ (t`^ \|`^ Nj^ Môـ؀d]ـ؀h]ـ؀l $]:t`^ E |`^ j^ uق؂d]ق؂h]ق؂l4$]Et`^ |`^ j^ Eه؇d]ه؇h]ه؇l$]|Eh t`^ o|`^ aj^ Uف؁d]ف؁h]ف؁l$]Et`^  |`^ j^ Eن؆d]ن؆h]ن؆l$]EVt`^ |`^ j^ Mه؇d]ه؇h]ه؇l $]VE,t`^ |`^ tj^ Eق؂d]ق؂h]ق؂l$] E8#t`^ 3|`^ %j^ }ن؆d]ن؆h]ن؆l<$] EDžx,ut}݇D ė [ Et`^ E?iڤ L[ ]EEL} E}``^ ډUt`^ |:u͋M:D #9uGUt 9E.]L;uF E NUȃfM1ҍYptvN]ȃfptIptNȃf]vLVȃfum;ULV]ȃfuELV]ȃfu)LVȃfu녋Uk ė t E9EUĐ ^t؞ӃZ#t؞t؞t؞tˀ؞t@؞,ن tUL:M $$ D:[ MYAYAنQ YċYAȋ:H tYAċQȋ]Sؖ,~ ن}‹]E´ fEm[mنm[mن<m[mFtm[m‹M'ܤ90 [نm[mC݄90 [}Mx~[ Qx~[ ؞, ن HuNEEL} >|?|u PW UG ė  ] ?M ='t7 '''iѪ''''$ 뻍v'UWVS }C1?8`'|$$讏 ^`'ޅ|$$膏`'|$$`s`'|$$:s`'ty|$$tys`'t[|$$t[s`'t=|$$܎t=s`'t|$$辎ts|$$ C [^_]1 [^_]Í'U8]eE1u}D$D$$w?uev 󦹐8tf 78uUe3u:]u}]É\$$, x  L$$莐UWVSL]MeU1҉ $D$ Թ'D$m D$@T$ T$&'5!1نٽ  t`^  f٭ ٭8&    8   i  8u  !X + d'Jp= <R!=  5!  !5   !=  !  =!5  !=  5!  !5   !=  !  =!5  !=  5!   !5  !    5!X +d'Vp= t袽=!  !=   !5  !  5!=  !5  =!  !=   !5  !  5!=  !5  =!   !=  !  5!  $t`^ D$D$DžDže^ Dž`^ t&x tD$ D$<$}  ƴ´t\ x tD$ D$$)}G ´ôɉt\ ux tD$ D$$|O@ h h h t\ x tD$ D$$X|` & 1\ #X ǃĿdž0x D$D$$褋D$D$ $膋D$0'$ǃ\ X ǃĿǁ0x dž$D$D$"D$D$$D$0'$茌ǃ\ X ǃĿǀ0x džh $D$D$蠊D$D$$肊D$0'$ ǃ\ X džĿǀ0x ǃ$D$D$D$D$$D$0'4$舋dž\ = tZl`^ ''L( $ٽ0  f٭۝ ٭ o  $A ٭۝ ٭ !5 t$莄$ D$= ~  P u ]  ؞zD$D$$'贈 ĝ = |'x''p'<'ٽ 8'D''''''' f's(''?D$@D$ L$٭\$٭<$ dd$ 114$' '#$' @T `'!Dž't& $rj^ j^  D$ D$ $Gwj^ ǃ8 d <$b ҉!$j^ j^ D$ $D$vj^ ǃ8 d  <$ ɉ$tj^ j^ D$ $D$Hvj^ ǃ8 d @h <$\ ɉ$j^ j^ D$ T$ $uj^ ǃ8 d ` 4$ ҉`T j^ U tz؋5 jD$ D$ D$H $@  7`T j^ `T j^ s`T j^ !!!D$@|$$Թ'tD$ Թ'D$ D$@$'蒃D$ X'D$T'D$$'\'4 `' `' =\'eT d''=d'4`'4$`'9|۸v ̹' r'$й' Å4$sD$@D$'$[sCt?ǃ@ǃ@d $7$ 7ǃ|> !Q$ٛT f!<$ٶD$@D$Թ'$r! ٘ :ٽ0  f٭۝ ٭ tJD$Թ'$ }$/t*D$Թ'$ M= u?$4=D$ D$ D$ $@ = t$ gj'T' 'T' ''85''D$ D$Թ'D$ '$@  5$ cnEe3L[^_]á!d4$Ey=!d4$ED$K $  ٽ fbD$ D$ D$H $@  S$'R5,5!$Թ'55!`'`'Dq輈4"D$b  $d'V$; $@ "ۅY"ۅZ"ۅ 0[(="ۅ$_4"ۅ(X@ "ۅ,YL"$5X=!'_|!@p+5("i98 $Cu]t$$P T$xD$@\$$Թ'%oD$ Թ'D$ D$@$')~D$ X'D$T'D$$'}\'$ |US1t/ٍB<vB<vB< wu)ٍY&[][1]Ív'UUx~k|X Ƃhǂx]Uuu]݆xt  s ؋]u]Ðx ($ T$$D$D$D$4$D$ ]uu]#vUWVS ~U111t&|;= }=|t t$zD$ $|t2|;= |$z$y D$v [^_]Ë]u0 xptL$uz$K D$ev [^_]džt $Gz$7 D$7v@p@P$z$c D$ vjUWVS  u$ u [^_]$ u ~N111|t t2 t  T$D$$ u |9|T$$ eu [^_]Í'UWVSD$  $ wD$ ${ 1 =j&CTT$S)T$ \$D$D$ <$v;5 }2|SttKxtK)T$L$ \$D$ <$wvÉ<$y[^_]$ t UWVS$ nUWVS br ~S111|;= }@|t t$4r M $D$st2|;= |$r$ D$m [^_]ËX u0džt u- $ t$m [^_]_iشX $$ m [^_]Ðt&U8ٽp eE1uu]} f٭۝٭x~Ue3]u}]Ãt`^ T$L$ D$$ |$|nieܯ$%x~Wk|hD$$ǭ |$bIVdv4$Xdžxdžx(Ɔhd 8u7D$<$D$<$D$, <$31D$D$4$2bD$D$ 4$jdD$<$D$<$zt$<$fot&U$` D$`($ ~D$$$ v~D$P$  b~D$$$ N~D$p$$  :~Ð&UWVSLn]=  $nU܉T$$N6nE9 11۾ EE"}Uă||; t t$3n4$D$oth}tEE$ nnmESt&}w$m4$D$ou ;E~$_ i1E }( $tmD$)D$k}| <$_Am}҃EҍV fE m]mҋ]̅uv$mD$D$)ku|) $l_džt U$x l$u D$hxL[^_]$* hL[^_]Ë]ȅu$l$v$@ hL[^_]D$($L hhL[^_]É}D$($ Dhw$3lv3$P hJUWV SD$  $ iD$ $ns<$$iD$|D$4$nt$D$m <$jF\D$4$)3^)D$)t$$]VtFxT$ \$D$ <$jVti<$|hf i{i<$ lE``^ ]Et`^ }Et`^ |8vx8d~m ~N1 tw95 ~5|CxuUD$$hT$juʃ{t]DŽ;dƄ;TE} a[^_]Ðt&U: D$: L$ : D$:$ L$g$D$g695 j{t`SXuFNu>d{xtJCXS^TFtN)\$D$ L$D$ <$hR{x UN:d}C)D$D$h<$[$ Ue``^ t`^  ڍt`^ d~ DŽdƄT(6d d~ DŽdƄT j d~ DŽdƄTo d~ DŽdƄTDu d~ DŽdƄT{ d~ DŽdƄTb d~ DŽdƄT`8 d~ DŽd. ƄTUSLÅt$̧   Ļ L[]É'US]LtLu[]Ít&'USU:t[]Ë\ CP11@CCC0CDvzCXvgClvTكv9كv#àCKIؐt&؍t&mؐt&N4Ҹ't.R$}U fU m]mE[]؃[]  p }E fEm]mEt&'U``^ WVSp`^ } U fUm]mEx9p`^ 1(6d t`^ 8*t 9`*tύ(6d 8*t 9`*t j 8*t 9`*to 8*t 9`*tDu 8*t 9`*g{ 8*t 9`*Jb 8*t 9`*-`8 8*t 9`*. [^_]ûp`^ '@U v AQw]ÉAQ]!ʉ UWVS = ( }U fUW m]m( J9t&t|tQt(5( u#( ;( 0( u#( ;( ( u#( ;( ( ( ( ( 9( u#( ;( ,Q( u#( ;(  Q0( u#( ;( QH( u#( ;( Q`( u#( ;( Qx( u#( ;( ( u#( ;( tg( u#( ;( tG9 m]muà [^_]É# ( ; ( E [^_]É#( ;( Lߐt&#( ;( Eĉ#( ;( C뮍t&#( ;( t9BQ}M fM?t&'UWVSEp= W9( 1H9OtptXtAt*t9( 9( 9( 9( 9( 9( 9( 9[^_];( u ( 9( &P9( P09( PH9( P`9( Px9( 9(  9[9( Y9( u;( i( \1[^_];( X( tP09( O;( C( tPH9( :;( .( tP`9( %;( ( tPx9(  ;( ( L9( ;( ( 1;5( j=( ]1;( ( ;( r( e1;( d( W1;( V( I1v;( H( ;1V;( :( -16;( ,( 1UWVSM y9EU4I( փCIՀ( K Մ( C Ո( K$ Ռ( C(Ր( K, Ք( etGC4I( K ( S ( C$( K( ( S,( C4I( K ( S ( C$( K( ( S,( AՀ( AՄ( A Ո( A$Ռ( A(Ր( A, vՔ( S0B̀( r4̈́( B ͈( r$4͌( B(͐( r,SH`4͔( Bt( J ( B ( J$ ( B(( J, ( OsI4Հ( CՄ( K Ո( s$4Ռ( C(w;uՐ( K, Ք( K] [^_]Í&'UWVS ] E.#  E;$ u1EFƃʉ߃E#8 ;< t&tat?tΉ؃E#8 ;< |ʉ߃E#8 ;< _Ή؃E#8 ;< Bʉ߃E#8 ;< %Ή؃E#8 ;< ʉ߃E#8 ;< U9UU#8 ;< qE#8 ;< y0r؉uqH#8 ;< z؉}y`#8 ;< tqr؉uqx#8 ;< tXz؉}#8 ;< tuC'UWVS,$B$M E> }11H$ >݃( un$ j>95 ( UEM$[ T$UD$ L$T$*>( u$ >뇉}E$n U fUm\$m=gv$ =D,[^_]Í&UWVS,Eu} M $#?EK NSVClFKN SNVF $\$ D$v D$@$\$ D$ D$ }@\$ D$ D$ $[@|$\$ D$<$=@,[^_]ÍU$@Edž#badC datfCe#C ,[^_]ÐUVS0DLeE1uu-$ a<Ee30[^]Í&$t 4<$ (<H( tsu [tstKS$D$ T$'S  tT$$ =K ~UԉD$T$$ D$L$ T$D$|;^?UWVS,u]} $>?$<MP V@FKlNSV CVF N$\$ D$v D$Q>\$ D$ D$ $/>\$ D$ D$ $ >\$ |$D$$=,[^_]Ídž#bad@ datf@e#@ ,[^_]ÍUVS u]$">$;H NPV@lFKN SNVF $\$ D$v D$C=$\$ D$ D$ !=\$ D$ D$ $< 8u [^]Í\$ $D$D$ < [^]ÍNF#baddž#baddž#badA datfAe#A B datfBe#B @ datf@e#@ [^]Í&UU ED$@T$$8=Í&'UVS u]$<$*:tN@ F Z^JlNBFZ^ T$ VD$ D$$; [^]F FFFFFD$D$ $z. [^]ÍvU(U]uu}} kU苃 t >t9 } ]u}]$|}}t$ |$D$|$  R9 @ L$ ƉT$ $ D$&9ljt$D$m k] 4$9 $(9}E fEp m]m}. 4$;}M fMp m]m]9E > |$ $ L$k8@|$$m aE }]u}}]UWVS,]M }M}싃$t$ T$$L$ (D$,t$$ƉL$D$T$ L$D$OS,|$T$t$D$s(t$ x L$U$ T$X7EEEE ,[^_]lUSd]eE1D$ Թ'D$ D$E$|$cUqEe3ud[]9&UE $7 1ÍUE $6 1ÍUU $6@=6Bw%ȺC)1)щ( , $ r4Ít&'UWVS]E peU1ƅlƅh`ƅmƅiƅnƅjƅoƅkJЀ wS1Ƀ1B< vƄ p4$5=ktƄ=g;ttJЀ v1h`2lZUe3u Ĝ[^_]7 UE 8t$D$D$ D$. $@ B1D$. $@ J1ÍUS] D$^, $7t []Ðt&0Ҁ;t$e1[]Í&UWVSpeE1D$  D$j D$$ 8\$$5 c2D$ $8] 11ۅ"&95 ~i( u鋋( ݃( \$D$T lonm<$T$lD$L$ T$395  11ۍ&( tn t t ( T$݃( \$D$q lonm<$D$lL$T$ D$295 u<$6CEe3uļ[^_]É\$$B 0]5t&UWVSpeE1D$  D$ D$$+6\$$5 0D$ $7 ~d11ۋ$ ( D$ <$loL$nmT$lD$L$ T$195 <$4Ee3uĬ[^_]É\$$B /N4U(}NjE]ˉuօt2Ҹ ~E t$D$|$ D$ D$$*t$$mg 21S,($|$D$ D$ц$D$ !t$|$$ 0$D$a]u}]Ít&U(D$Eȃ,]Ӊu}M$ylj$09؉h9|@D$$mg 0<$D$L0t2?t-ME$t&ME$]u}]ÐMڋE$܍v'U$ $ $ $` $ ÍUWVS,p$ W$ K$ ?$` 3$ '$ $` $ $ $ $` $ $ $` $ $ $ $   E@ MU2Y4$1}ptthtNt&t0tEfX$0t0U  $0t0E$0t0U  $p0t0E$[0t0U  $F0t0E$109}t0]$0U\0t4$0t]D$/\0uL $/t]D$/U\0t4$/t]D$/M\0t4$/9}t]4$'d   ~F1ۋ@ t$=d <$D$# d t$D$  $#9  $` `T hdD$ D$J$@$ D$ K0$` 7$ +$ $ $ $` $ $ $` $ $ $ $ $ $ $ $` w$ k$ _$ S$` G$ ;$ /$ #$ $`  $ $` $ $ $` $ $ $ $` $ $ $ {$` o$ c$ W$ K$ ?$ 3$ '$ $` $ $ $ $` $ $ $` $ $` $ $ $ $ s$ g$ [$ O$` C$ 7$ +$` $ $ $` $ $` $ D$@$/ s:D$$ _:D$$ K:D$]$ 7:D$ $ #:D$ $ :D$ $ 9D$ $ 9D$D$|$l {;D$D$z$ _;D$pT$) 9D$`$4 9D$v$ s9D$`q$ _9D$`F$% K9D$b$0 79$ {$` o$ c$ W$ K$` ?$ 3$ '1$ ~\$ 4$D$< D$+C<$~D$ D$< D$*KV L$ $D$< D$*C<$~D$ D$< D$*KVL$ $D$< D$z*C<$~#D$ D$< D$X*KV(L$ $D$< D$3*CD$ D$< D$<$* @ p@!D$ D$@ D$ܺ $@ _xD$k$mg %D$ D$N $@ D$+x$'D X x \ ` P  h`^ H l "" p t d D$U $萅ljE]O wL$4$@@D$ l<  ( T$$D$ lH@ \@\$`` $D$ hl|` h`T$$D$ 9$ -9$ &9$ t&9$ 9$ 'UWVS<$ U܉T$$,u$$| $e D$l<[^_]$X $E E$ ]11Ƀu܉]9  < tqtKt&t!9  < 9  < 9  < n9  < M9  < ,9  <  9  cW9Ủ?< A9  ^< zX9  O< zX09  >< zXHt~9  1< zX`ta9  '< zXxtD9  < zt$9   z< u܍ ]}EU4  uЉ, <4 $ 4( 0 <[^_]1;}uG ;Uڡ EE2뿐t&;]&;Mt&;Mt&;Mt&w;Mg;MW;MG;U7;U ';U1;UB;US;Ud;Uu$ ov'US4D$?UH( U1 Ctxى9Su{uCAUUUT$ML$ ED$U$< T$C t$p$p-DLA4[]$$d D$4[]$ 4[]$ 4[]ËK H( T&UVS0#~~$"t^1ۃs\$ t$D$$t2@Eut$]\$ ML$U$ T$0[^]Í&$ 0[^]$$@e\\UWVS\$ u;u 1\[^_]D$ $tߡd 18uf$1A9Ív}$t$$uى$D$ $tC{o1D$@D$<$d $5A1v$xD$ D$ D$$=9|ɋ$  'USxeE1ƅ{ƅzƅyƅxƅ|nƅ}D$D$ $  $ ( , \$L$ 0 T$ 4 D$8 L$ىT$D$!‰%t u)ى $Ee3u Ĵ[]t&UST$eE1 ¡h`^ uEe3T[]Ðӹ)ÉD$' D$ )ڍ]؉T$ $:[ $ ( , \$L$ 0 T$ 4 D$8 L$ىT$D$!‰%t u)ى $9t&'U$9!7vU$ 7vUWVSLeE1~l$ Ɖu;D$^, $tD$ Ee3L[^_]ÿ ƹu$ j$\Et8 v> w<w <v@}@}uZv"$E@t }U< vUЃ< wUЉT$$@ \t8uMЉL$$`T k\"O}t#t Bu"y<= tu$ t$; D$@}$ T$]$D$:P wt"u">t>WL؈Pu"y5WUS4  D$ X $xx; }p@( ( EML$UT$ED$ MD$. $L$$X$L ,;_&\$$ 4[]$ n,\$$ T U  eE1]uD$ X $j;tu&$ Ee3]u]~A$]\$$Vu0$$U D$럍t&$$ 덉$jtW$]guD$ $D$Mt$ L$D$ $Mt7$ $*$$n D$ !‰%t u)uE=~!ER$U``^ h >``^ >``^ E} V>u$ ( , =0 \$4 8 L$T$ |$$D$(\$, $T$|$D$ \$L$C 5h|x $ D$$ n<[^_]á$ ( , D$0 L$ 4 T$ 8 D$$L$(T$,$L$T$D$ L$T$I>``^ q$ ( , D$0 L$ 4 T$ 8 D$$L$(T$,$L$T$D$ L$T$h >``^ $ ( , D$0 L$ 4 T$ 8 D$$L$(T$,$L$T$D$ L$T$`>``^ m$ ( , =0 D$4 L$ 8 T$ |$$D$(L$,$|$D$L$ T$|$$  :  :J :Z :Bh|=$ 5( , 0 |$ 4 =8 t$D$ \$$L$(|$,4$D$\$L$ |$t$@$ -h|D$ ( , =0 D$4 L$ 8 T$ T(d |$$=X(d D$(\(d L$, `(d $d(d |$=h(d D$L$ T$|$E=$ ( , 0 4 |$=8 \$i D$ i L$$ i T$(i |$,=i $i D$L$T$ |$\$qvUWVS<} p }E fEmUmU܅~q H` v;@H@؋@@m]mE9~؍v<1[^_]Í؀?t m]mM܅E$,$8@(蟚$!@)腚$4@*m$ @+S$ 4 @,5$@-$4@.$@/M0 }UE fEm]m]܅u'T$ $^E6$$-3$ !3<$3$($3$ 2#t&$$2$ 29s2$|$D$($ƒ<[^_]Ð$T|$$<[^_]؋5$ 0 ( , 4$4 58 T$ \$L$D$t$D$ }] f] @p m\$m$ L$N#p  }U fUUWVS1ۃ p$$a9|4$1/$Qt$<$D$t$D$ <$9|ȉ<$D$ <$B [^_]UWVS}] eE1D$t`^ ieܯ$^$t$^Ŀ$D$]D$$$^t$$x^<$$D$]D$5$T^t$$H^O$$L$9^D$%$)^t$$^ ܧx$\$\,T$D$$e $D$_ND$($]t$$]W($T$\D$$[Ee3u [^_]Uuu]] }~,!‰%t u)QT$$誰tt&`4$L$u]}]](}u]E u]'UWVS,uMUE }u] uMUE}}$D$($0'|\\$$0'l\t$$0'\[D$\$0'H\D$m$0'4\D$s$0' \D$g$0' \D$\$0'[D$1$0'[D$\$0'[D$r$0'[D$a$0'[D$t$0'[D$e$0'[D$\$0'l[D$5$0'X[D$0$0'D[D$0$0'0[D$0$0'[D$\$0'[D$w$0'ZD$_$0'ZD$s$0'ZD$w$0'ZD$i$0'ZD$t$0'ZD$c$0'|ZD$h$0'hZD$\$0'TZD$2$0'@ZD$\$0',ZD$b$0'ZD$_$0'ZD$s$0'YD$w$0'YD$i$0'YD$t$0'YD$c$0'YD$h$0'YD$\$0'xYD$2$0'dYD$\$0'PYD$n$0'D$t$0'$PD$f$0'PD$_$0'OD$m$0'OD$e$0'OD$d$0'OD$i$0'OD$c$0'OvD$t$0'|OD$f$0'hOD$_$0'TOD$s$0'@OD$c$0',OD$o$0'OD$u$0'OD$t$0'ND$b$0'ND$l$0'ND$u$0'ND$e$0'NvD$t$0'|ND$f$0'hND$_$0'TND$s$0'@ND$n$0',ND$i$0'ND$pD$r$0'MD$e$0'MD$d$0'MD$t$0'MD$f$0'MD$_$0'MD$s$0'zMD$o$0'fMD$l$0'RMD$d$0'>M?D$t$0'%MD$f$0'MD$_$0'LD$d$0'LD$e$0'LD$m$0'LD$o$0'LD$t$0'LD$f$0'LD$_$0'lLD$h$0'XLD$w$0'DLD$g$0'0LD$u$0'LD$y$0'L D$t$0'KD$f$0'KD$_$0'KD$p$0'KD$y$0'KD$rD$t$0'~KD$f$0'jKD$_$0'VKD$s$0'BKD$p t&UVS]u D$%$0'K\$$0'Jt$$0'I @'  L$$f@'58'  D$t$$  'x' L$T$$H$p'c"E0'[^]Q"UVS]u D$$$0'NJ\$$0'>Jt$$0'nI @'  L$$覝@'58'  D$t$$U  'x' L$T$$G$p'!E0'[^]!UVS]u D$$0'I\$$0'~It$$0'H @'  L$$@'58'  D$t$$蕙  'x' L$T$$/G$p' E0'[^] US]݃\$D$$݃\$D$$x 8C\ t ][],(D$ $vH;MCxx $0 D$SPt$IǃPt$-ǃƃ $i1 ݛx;h|!h|X C,ǃĿǂ0x D$D$$,$D$D$$D$0'z[]Ít&D$D$ $vx $F L$:t&CuKX !+d'Ap tt$n|x $ T$0"t0X !+d'Bp t9$( u !\$肪 0" $ov'UWVSE} eU1ҍH,EM $D$K *MM $D$PED$tMtyփ\tR tM tH$vt@"u39&QtG׃\t t t$t"t ;vu΋d ED$P$T$Et; u3U u u9UtMD$PT$ $M!ډ%t Q9U+Mt  9UthtMt2tt  t  t  }t  gt  Q7>9Ut  Jʄt  t  AQt  AQt  AQt  AQt  AQt  uQ9U@u}|$4$U:=d uD$ D$K |$4$3]D$K $&E``^ E޻t`^ t`^ |1ôx ôt`^ |~t`^ |h t`^ |t`^ |Vt`^ |,t`^ |8#t`^ |(t`^ |,.t`^ |E T4t`^ | 9]UT$d $M $v]CU:(ED$E]}D$Y D$PD$ $UML$D$ D$K $1ED$K $$}E&؋uF ^E8v/Pu(E\$D$n $D$ Mx uD$ $t$U:vD$D$ $/MD$C  $\$UD$ | $D$}P~ED$ $$É$a$Q1ɉD$EP $fUP$=` ݚ}D$1 <$#8d]D$ $#8^Mk 覩Mk\L 蔩Me3 Č[^_]Q9U\UML$D$ D$K $/ED$K $#EU:D$ $}x $#u\$4$D$='MA  EUxOJ\$D$d $}D$ D$<$zuD$D$d 4$Ϡ]$$9]yML$d $[Ov9EaML$d $C t&9EHML$d $y*t&9E/ML$d $It&9EML$d $t&9EML$d $`t&9EML$d $0t&9EML$d $t&9EML$d $Yt&$u $}uD$ 4$ 9]KML$d $-Z B u9Uu]D$ $z)tMy)"ȃЃv'UV``^ Sރt`^ $ 0D$$ <;D$$ (;E$ D$u9D$$ ;3``^ (ô@A 36d 3 j 3|o u30u A3{  3b 3L8 3 wu3 wHY:3``^ j   $D$L$@A I[^]á K:  $D$L$车땡 du4  $D$L$蚦e .  $D$L$t5 (  $D$L$N H"  $D$L$(   $D$L$ H  $D$L$ܥe ,s  $D$L$趥1 x  $D$L$营   $D$L$jt&UWVS,ueE1} ]ƅUT$ \$D$$P(  [ut`p t   P( L$$[K >9tK :F~;";9uK :S  ;?0 ( 4 $ =, 50 8 T$L$$|$t$ \$_$ D$诱D$nD$ ]}v5$ , 4 ' 58 1 ' ( ٽ0 ' ' ' ' ' f٭۟' ٭95$ =( , 0 4 8 t$ƅm|$ \$L$T$D$t$$”EcE " ޹m) ޹ X 4  = .G $ ( 5, =0 8 4 $L$t$|$ D$\$耖$ T$D$膱i4$D$ JƉ$DžDž$D$ h8 $ =( Dž``^ ,  0 =4 t`^ ft`^ D0ô@A t`^ D9t`^ D:h t`^ L: t`^ D9HVt`^ D1\L$D$T$ |$$L$($|$D$,L$T$|$D$ ;1tf;1ۃ- 0  43<$L$T$t$D$ |$襓$Y D$赮;;t`^ 1DžDžDžtnыTtDžt`^ \ыTDKt`^ LыT\h Ttu@A =t`^ \ыTDt`^ LыT\h t`^ LыT\Qt`^ L?ӋTDVt`^ LӋTD,t`^ LtnӋTDv8#t`^ tE^D$D$$L;uD$D$$뇋@D$D$$D$D$$dD$D$$菱AD$D$$^D$D$4$-eL$D$T$ L$$D$( $T$,D$L$ T$D$T$较4;8f;8vT$L$D$ T$$L$($D$,L$T$ D$L$D$\;9-f;9.L$D$T$ L$$D$( $T$,D$L$ T$D$T$Mi;8vf;8;\T$D$L$ T$$D$($L$,D$T$ L$D$L$蔁;:f;:/dX}]Q ٽ  f٭۝٭  0 ٭۝٭ l p ٭۝٭   0 ٭ە٭V$  ٭۝٭R$p   ؋Äɉٽp  f٭۝٭9@0 ٭۝٭9|CG(,\$<$D$՛t`^ io!ieܯ@*@t*8FT`bp9u$L$\$T$ D$L$D$jD$ |L$ \$T$D$\$T$D$ $|ǃ ´ ǃ CK D$N $$C_D$N $$R9X \$x 1ҋx  ; D$D$ D$  $1D$$ tM1ۍ,D$$D$ 4$D$ D$ ut$<$Yt=;*u\$ $L\$D$ ,D$$h먋ݓǃݓǃDݓǃHݓݓݓݓݓݓݓݛ0ٽ  f٭ۚ٭ǂ5 r!!=!!5! !!=!!5! !!=!!5!X  !$5$Fٽ  f٭۝٭9D$L$D$T$ L$D$蔄$g D$4u@ٽ0  f٭۝٭9ٽ0  f٭۝٭9gD$nD$| $\$L$D$ |$t$%wtٽ fD$nD$ m%HD$D$$袤_D$D$4$qD$D$$t`^ JDžt`^ tK :V?$賡8*;tK : K :K4$ ;CDž  $ , ( =0 4 58 $T$D$|$ \$t$$ D$D$nD$X $ՠ$\衉D$t $tٽ  f٭۝٭9L٭۝٭)փ V$\$$`  5@T x T(d T$L$ |$D$X(d D$\(d D$ `(d D$$d(d D$(h(d D$,$D$D$u;1Af;1'$ =( , 0 $4 8 |$\$L$ D$T$.Dd ;DžDžDž٭۝٭ )S$\$$ 3ٽ 0  fD$B$ a3ٽ feD$B$ 23ٽ fD$B$` 3ٽ f.$A t$貛cDžT=!` $dٽp  f٭۝٭9ǃ8C }D$ <$=D$p 4$- $D$t D$ D$ D$ $DžDžDžVD$ <$D$ D$^ D$ $x4$耚DžvD$ $t$$贙$ 0 =( , 4 58 $L$ |$\$D$t$|$5 D$赗D$nD$|  $D$x j$貙zٽp  f٭ە٭٭۝٭<$\$L$D$ T$D$nD$ |$6oD$ D$^ D$ $Dž&D$ $Xt$$$ 4 =( , 50 8 $L$|$D$t$ \${$ D$UD$nD$, ٽp  f $t$|$D$ \$T$z$ D$菕rg $T$ t$D$L$|$#z$I D$3$+$KD$ $t$$袖ЉD$ $$i~K=$ ( , 0 <$4 =8 \$L$D$ T$|$=$i$!K<\t-<\;;-<\uz\&tD$nD$ t&UWVSlE] }%}    !t1ۉ]E  'uE  E'' t`^ E``^ t`^ ]% EE]؋H u~|viUE؋LU؜v:t"U䋌d D$ $L$R4$ED}䋌dU|ƴt@A 0E䍾t`^ H u~|viUE؋LU؜v:t"E䋌d D$ $L$衈4$IUDE䋌dU|E䍷t`^ H u~|viUE؋LU؜v:t"E䋌d D$ $L$ 4$豯UDE䋌diU|E䍷h t`^ H u~|viUE؋LU؜v:t"E䋌d D$ $L$q4$UDE䋌dU|jE䍷t`^ H u~|viUE؋LU؜v:t"E䋌d D$ $L$ن4$聮UDE䋌dU||VE䍞t`^ H t|vfLE؃U؜v:t"M䋼d D$ $|$@4$UD}䋄drE| ܤd M@A D5't ]܅Q1; }0݇ : 2; |DL D 4΋` *_ H  q 4$j$ ^u㐍t&$Td D$ $Au D$  $'\$D$$ τ= D$$ |$豄$ D$$ \$1葄D$ $` M!D$ $ 9!D$ $ %!= b = 5 =  $ 2i \$$mg jD$ D$ $@ D$ } U fUm]m]S$,}: mUm}W$(} ؾt`^ t&E䍞t`^ |‰=$  ( , =0  4 8 8tr Mܜ(s ='tO$ CU䋌8y|$A$ D$_4$N@(U䋄8u@A ƴ $z7 ܤd D ܤd fDY ܤd  D ܤd xDk4$4$v4$sv4$cv4$Sv ,}U仠`^ m]muV$4`^ (}vi%d  D$ $`^ 8 $Ό}䋴;%d D$ʉ $8PE$=` ݜ8(d t`^ ôK${M䋴 %d D$Љ$8MP$=` ݜ 8(d @A E䍳Ǵ4`^ vc%d "D$ 4$8 $MD$1 %d $8UP$=` ݜ8(d U䍞4`^ ve%d D$ $:8$yM䋔 %d D$ȉ $7UP$=` ݜ8(d h h U䃼4`^ %d tD$ $8D$ $kD$ 4$D$ $yCD$T$L$ D$$$ T$(( $0 L$, , T$4 D$ L$ 8 T$L$awMU;df;=8 t$ c8 fܞ<̧ HLVP P̧  ̧ Pǂ P P $&  D$\$P$Bnt&& ;t`^ 6}%EL1ۋE]čt`^ ދL8l}čU}t`^ ދD:M䍳t`^ T9U䍳h t`^ L:E䍳t`^ T8}V E䍞t`^ TbdT$D$L$ T$$$ D$(( $0 L$, , D$4 T$ L$ 8 D$L$^ME;9_L$T$D$ L$$ $ T$(( $ 0 D$,, T$4 L$ D$8 T$D$d^UE;:lt&T$L$D$ T$$$ L$( ( $0 D$,, L$ 4 T$ D$8 L$D$]EM;8'D$T$L$ D$$$ T$(( $0 L$, , T$4 D$ L$ 8 T$L$&]wMU;9dKn6kI5' P":}]耄 e  W d}% }   ؃l[^_]=T(d X(d \(d `(d |$=d(d L$ h(d D$ $ T$$( |$(=, L$, 0 $4 T$8 |$L$ D$T$[EU;yFt&D$L$T$ D$$$ L$( ( $0 T$,, L$ 4 D$ T$8 L$T$F[UM;:  $ 5D P H 5D DD $d \$讒@@"u$8 H^$    ,  4  <       l[^_] .YD    18zLPD$ D$ D$ $@ "ݬ%Ĺ'=P"<$J4$GB$ D$ $uKI$ \$$ !1'X|!Bp"s @" $kJ="uE_:4$U|i ܤd KD>D$ $RD$ $`^ 9 UuD  t$诃  t$蔃  t$y ԣ t$^ԣ  t$C  t$( ( t$ ( ;(t謣YD$ D$$E U(``|tD$`$ SUM ML$ D$T$$``D$`$ @}D$`$ ~$褨OD$`$ ۮÉ'US]ST$$ż$  tC U  S C K  C =TD$C$JNt&軐v8q@ lkD $ tH;  $ bt@;  D D$D $@ bT  iMlG;VVD$; $$L L( ܛ$[ Л$l ě C $t \$a{,$ P{ 6D $@'d|t-[]ÉP$ $ \$CC M$ $3@ 'uE []D$< D$$BD$ D$$BC@ L $|$* D D$Uz= @ D$n|$ @ D$)zt&U;(tD$v $@ D$D$ $eɅÍvUWVSeE1}x}Ét  :uEe3[^_]Í $D$D$D$\$$!ډ%t ``^ t`^ f 8``^ (6d &@A A;``^ ]h ;``^ ;``^ V;``^ ,;``^ M8#;``^  (;``^ .;``^ T4;``^ uDY:>``^ &D$ D$ 4$3T$4$/D$ D$ $3L$$]/D$ D$ $S3D$$1/PD$ D$ $$3T$$/ D$ D$ $2L$$.D$ D$ $2D$$.D$ D$ $2T$$u.@D$ D$ $h2L$$F.D$ D$ $92D$$.D$ D$ $ 2T$$-t$ gtD$ D$ $1L$$t`^ -gz UWVS,eE1y'$l sEe3,[^_]$``^ t`^ ryD$ D$ D$$y6ƅÍ؋L/(6d ٍt`^ Dt ;\@A ؉΍t`^ |t ;\t`^ |t ;\h t`^ |t ;\t`^ |t ;\Vt`^ |t;\ty,t`^ |t;\t`8#t`^ |t;\tG(t`^ |t;\t..t`^ |t;\tT4;\[$wD$$D$u9!%t uf zw9|!ډ%t f E!‰%t tN+D$ 4$QT$.L$4$*L\$$o q7kJwUWVS L ]eU1ҋ5\ P $T ` =X `] T$L$t$D$|$ L D$  $W T$ t$U$q؞up st$4$\$؋]u}]Ë<$Ng$J' D$N>ǃ뜉$"g$0' D$">ǃv$f$J' D$=ǃv $f$0' D$=ǃv$f$J' D$=ǃv$bf$0' D$b=ǃvUS$]ك}U fUm]mEt$]$[]ك]$ ]D$?$$؛D$  \$D$$>D$$ntك}U fUm]mMVE& M?D$?D$ D$b' D$$7D$ [vUuu]}4$tr؞نٽff fd٭d۝`٭f`R$ٖ٭d۝`٭f`t ]u}]É4$8ن ؍ D$\$|$ ]܉<$\$<$ \$,h\$ $t$flhptE|Ux]]EEUUMM]]E]MċMUȋU]ЉMԞUن? u?MȉT$ |$L$<$E' ن نٽff fd٭d۝`٭f`R$ٞ]+d'dždž(dždždždž4$K (  D$?4$ نٽff fdن tt&UU'Rlt9Zlق}M fMm]mE vD$$s' 販$( UɐUrUU U&U!ud'ǂ ]  ?$#E Ð&UWVS='t[^_]'tD' p U ٞ  '  ? ! ٙ`'d'~^1NwC4"95`'~BË;u!ؚtD$$!oNv$뮋!ق{%( ٚ5 =4   }``^ ]c``^ t`^ ٍt`^ \t8  tD t#~iX +d'´t`^ Tt8  tD t#~iX +d't`^ tt8  tD t#~iX +d'h t`^ tt8  tD t#~iX +d't`^ tt8  tD t#~iX +d'Vt`^ tt8  tD t#~iX +d',t`^ tt8  tD t#~iX +d'8#t`^ tt8  tD t#~iX +d'(t`^ tt8  tD t#~iX +d'.t`^ tt8  tD t#~iX +d'T4t`^ tt8  tD t#~iX +d'@A t`^ ߍ6LtH ƴv@A Át`^ ELtH uƴt`^ LtH quh t`^ TtH 5ut`^ DtH uVt`^ T?H 05  D 4 g` $D$RL P T  X  \  ` $ ( , Ƅ. dž` džd džh džl džp džt 'ݜ0 DŽHj}]=4   [^_]ã  D 4 f$D$BL P T X  \  `  $ ( , Ƅ. udž` džd džh džl džp džt 'ݜ0 DŽi5  D 4 eED$$UL P T  X  \  ` $ ( , Ƅ. dž` džd džh džl džp džt 'ݜ0 DŽ5  D 4 dMD$ȵ $jL P T  X  \  ` $ ( , Ƅ. dž` džd džh džl džp džt 'ݜ0 DŽ5  D 4 cUD$|$+L P T  X  \  ` $ ( , Ƅ. dž` džd džh džl džp džt 'ݜ0 DŽ5  D 4 bD$$j^ >L P T  X  \  ` $ ( , Ƅ. 'j^ j^ j^ j^ j^ j^ ݜ0 DŽ{UE] @ ÉUWVS}tX D$D$$u!wt~ iдX ك,ٽrr fp٭p۝t٭r8 $$U$l|a=ك@ٽrr fp٭p]٭rك٭p]٭rكD٭p]٭rكH٭p]٭rكL٭p]٭rكP٭p]٭rWt ~ك4٭p]٭rكT٭p۝l٭r !'lف٭p۝l٭rl Ut$Dt٭p۝l٭rl ‰U؛,كl٭p]٭rt;ȿtPȿt)D$D$&<$D$<${t<$\$)1ҍZt;ȿtOȿtD$D$&<$T\$<$t<$t$D$D$<$\$<$t<$t$st;ȿtOȿt[D$D$&<$t$<$wt<$\$$^t;ȿtOȿt5D$D$&<$Q\$<$t<$T$^t;ȿtOȿt D$D$&<$\$<$t<$D$`^t;ȿtOȿtD$D$&<$\$<$Qt<$L$^ t;ȿXȿt D$D$&<$\$<$t<$L$D$D$<$\$<$t<$T$D$D$<$\$<$jt^<$D$T Ĝ[^_]D$D$<$Xt$<$t<$D$ D$D$<$\$<$t<$L$=!|D$D$<$\$<$t<$L$uD$D$<$D$<$Rt<$D$@Dž|WZ?t&'UWVS,M} X 4$UE苂ؖu_؞uV;(t G؞UBt ܢH ,[^_]Ð؋d'D$<$zن}U fUm\$m<$zن}M fMm\$m<$hzك؃ U؃<$\$zك؃E؃<$\$yك؃EU؃<$\$ydždž<$D$&y<$D$y  '}] f]m\$m<$x} ݟH,[^_]D$ <$ky<$T$z<$L$z<$\$zM苖IxU dž5;(x~[ D$ $xU xU$xU T$x$xU L$Dz$xU D$.z$xU t$ztvD$,<$`xU<$D$Kx]ǃD$E$D$3WxU T$O$L$&vUWVS  $ Đ E( u U  ( uE$ v u ]Đ U`'Utl( uE  ( u U$ v u ]Đ E}tE`'3[^_]Ð&UWVS<} w E $T) ] D$ D$$( \$EEt`^ ``^ ߍ|Môt`^ |@A ôt`^ ރ|uȋUu UtU̅t}D } ف؁d]ف؁h]ف؁lUv} l؍U$|$}tU̍Hȃ0EЅ{' ' $D$T$sU Uu̅t}D } ـ؀d]ـ؀h]ـ؀lUj} `؍u4$|$|tU̍H΃2vEЅ'$T$^5' '$t$L$@A ==;(t+]Ѕ'='$xU \$|$r$'EL<[^_]Ë5' '$t$L$[r'4$D$' '4$T$L$ix5'D$$t$. ''xU L$D$$qOMUe]Ae]A$] gUMe]Be]B $] `EЅU UU̅t}D } ق؂d]ق؂h]ق؂lU } ؍E$y$ztU̍H΃2EЅ' 5' $T$t$pEM $Ky$tEEU$)y$tEEEpEE5'$t$ ''$L$D$7FuMe]Fe]F $] &US$ 'eE1UtKE T$D$ D$$ D$ $0'3q\$$0'oEe3u $[]'U $]ÉuΉ}+$D$D$|$$`t$$t]u}]Í&UWV``^ Sށ,M }]eE1\$ t`^ L$$D$ D$$m 3t`^ ; | |ô2@A _ôt`^ ; | |ot`^ ; | |=h t`^ ; | | t`^ ; | |Vt`^ ; | |,t`^ ; | |u8#t`^ ; | |C(t`^ ; | |.t`^ ; | |T4t`^ ; |@A 5;(6tf( t]9!%t tR+ zD$L$$@Ee3,[^_]릍yGye}!‰%t +D$$qt$(xU D$$l xU |$ $l=xU T$<$0k5T$D$$@}$@!t D$D$$$ @H.U6 t&'U8uueE1U}} ]9 2ET$D$ D$$CىEe3u ]u}]Z U8]]eE1Uuu }9 ~"Ee3]u}]Ðt&ML$ T$D$<$;(u5롍v!‰%t u)Aفt`^ ieܯD$$T$%xU D$$j xU t$ $jxU |$$i[.UVSpeE1  tLt&v"=@iд G  G Ee3 mp[^]Ã=@$ ND$D$  $躾  D$ $t5  D$ 4$~@v$ D$$D$_D$$D$ $/@'vƅƅƅƅƅn$ m$D$ D$$ ( 0 , T$4 D$ 8 L$\$T$D$t$4$$-|KvUVS UM eE1L$ T$D$4$ tw!ډ%t $ v)Á~D$@t$$ Ee3uu [^]Ét$$m +t$D$$`|tt$D$$럐t& xDt&t&'US$UeE1p t7M L$ T$D$$|\$$m dEe3u $[]v'UVS UM eE1L$ T$D$4$ tw!ډ%t $ )Á~D$@t$$ Ee3uu [^]Ét$$m )t$D$$`|tt$D$$럐t&KxDt&St&'UWVS eE1K=;(ٽR R fP٭PەL٭RL ٭P۝L٭RLH( 5L`^ u'%U sDžH``^ 11H(6d L`^ HK``^ HK6d bHK j @HK|o HK0u HK{ HKb  . H X 9 ,=p[ DžD$ p[ \$$ĨU X$l) $z;xU t&5xU H$) $xU K;5[ p[ 'U ?iƤ p[ p[ ݘ[ [ + [ <J=xU [ ?iѤ <$ˆ[ T$Ee3 [^_]P$ ٞ '%U R%CٽR'U R fP& =  qbDž DžDžDžDž@DžD(6d DžM胄u}܋]|$$^\I.D$D$D$ D$D$ D$L$$,\I.D$D$D$ D$D$ D$L$$i\I.D$D$D$ D$D$ D$L$$ \I.D$D$D$ D$D$ D$L$$WQ\I.D$D$D$ D$D$ D$L$$\I.D$D$D$ D$D$ D$L$$\I.D$D$D$ D$D$ D$L$$\I.D$D$D$ D$D$ D$L$$;c\I.D$D$D$ D$D$ D$L$$'Tx'<$D$T$B-'Tx'<$T$\$BW' x'<$T$\$`B'x'<$T$\$9B$p'\I.D$D$D$ D$D$ D$L$$t`^ D$D$$=@'58'xU |$t$$A ;('x'$k^ T$\$lA&U1҉t`^ t`^ v DŽ t`^ v DŽh t`^ v DŽt`^ v DŽVt`^ v DŽ,t`^ v DŽ8#t`^ v DŽ(t`^ v DŽ .$]&'U É'UWVS }~D$D$$@c$@_9fǀ@-tstVvt6t$@ffǀ@-$@fǀ@-$@fǀ@-$@yfǀ@-$@afǀ@-$@Ifǀ@-$@19fǀ@-$@$@fǀ@-$@fǀ@-$@fǀ@-$@fǀ@-$@fǀ@-$@fǀ@-$@fǀ@-~9fǀ@-M @[^_]ÐUiEE]'UVSt'DAtZu[^][1^]Ðt&US$H _< D$ D$p$V~wD$ D$D$* $$t$R  $B\$$* D$D$$D$`R }M fMmUm]j %Ovt  H D$ D$" $D$*   $@$$+ D$:D$$D$R$[]á< D$ D$$  ~ԋ hH $ $(, D$D$$D$ڞ  D$ D$D$D, $$[]p }U fUmUmMt %h؃$[]Í&U]&UU$'ɅÐt&UED$$Ðt&US4UM eE1D$  T$L$D$G, D$$_$Ue3u 4[]$U$ r$` rUVS0eE1EM L$ D$D$4$xD tH ٽ0  f٭۝٭C D tH t ` ٽ0  f٭۝٭u D$$iCxD uRٽ0  f٭۝٭tHEe30[^]Ë H t`tt$D$$訛뀋 $먋`k  D$\$ $;   D$D$a, $&UUET$$uME -  ËE)P$E - ÐUSD tptfH t\  D$T$ $S8 Ð1[]É ttttH uD$D$$Sƀ눡  `H $}D$c, D$$詙1[]á  `H $.$D$ $@+ L$&D$$D$>1 "=w(P t t4t&pƀ   `$ naÉ$t9=v\$D$$څۉ`$iu =D$, D$$ƀ$u D$$ fD$$D$~ t5'D$, D$$O5v   `H $D$c, D$$ږt&UE$ UMuE@ T$0 $Au $$, D$$yElUS4M] \$ eE1L$D$$9ٽ0  f٭۝٭\$$, uD$$D$荕ٽ0  f٭۝٭t $$mEe3u4[]É\$$, ^&'U]?&U]&Uuu]D$4$t ]u]É3Ët$D$ t$$, D$P]u]ÍUSt] UT$E$D$tM EЃt[]t1[]Ít&'UWVSUu] D$8@eU1҉Y$ 2Y$` &YÍt&UVS  xt$- 豺[^]$< 1蜺$ $\$1$^ D$l&ô|`^ |`^ h |`^ 4|`^ dV|`^ ,|`^ 8#|`^ (|`^ \t`^ Oj^ `^ ô$< L$T$膹|`^ ,t`^ j^ `^ $< T$D$I|`^ t`^ j^ `^ $< D$L$h |`^ t`^ j^ `^ $< D$L$ø|`^ t`^ j^ `^ $< D$L$耸V|`^ lt`^ _j^ `^ $< D$L$=,|`^ a11ҋt`^ t |`^ t`^ t |`^ h t`^ t |`^ t`^ t |`^ Vt`^ t |`^ ,t`^ t |`^ 8#t`^ t |`^ (t`^ t |`^  .$}0 E fEm]mU9=4 5!+=d'~p $z  ǀĿ   ݚx  A=  LJ5  D$ D$^ D$ ,4$  D$ D$^ D$ ,$  X G E=,"u  !5  !   !5  !   !5  !   !5  !   !5  !   !5  !   !5  !   !5  !   !'Y|=4 5!+=d'~p  "C X -$ t0=!'_|54 !+5d'sp$'4 $G$迳  AD$. D$$%z$- $i D$ D$ D$L. D$$Ԭ)D$. D$$跬 !\ $n|_5!`$U|,"$C|&'U8]  u};t ]u}]ËStC o5d > 11ҋt`^ t |`^ t`^ t |`^ h t`^ t |`^ t`^ t |`^ Vt`^ t |`^ ,t`^ t |`^ 8#t`^ t |`^ (t`^ t |`^  .$} U fUm]mu9v=0"u t44 5!+d'Fp $  ǃĿ   ݚx  @5  dž  D$ ,$  D$ , $m  X =  !=  !   !=  !   !=  !   !=  !   !=  !   !=  !   !=  !   !=  !   !'Y|=4 !+=d'zp  5"@ ^ $5!'^|4 !+d'Yp  ="B _ $ 4 $fB${  B D$< D$ < D$L. D$$辧sD$. D$$衧VD$. D$$脧9=!X$;wB5!T$"w !`<$ w0"$v  Qt&'UWVSL=< < 5<  < eE1< = f}͋= = ]ϋ= Eɡ= uЋ5= Mԋ = U؉E܉]M}u'UЉ$ZÍEɉ$Z\$$. D$7EE1& D$t$$ E}kU$A T$賬$`T D$8=MMu$E)E] ED$@D$ 4$X:}t&t&t\t<tD$@fD$ 4$آD$@D$ 4$轢D$@D$ 4$袢D$@D$ 4$臢D$@D$ 4$lD$@D$ 4$QD$@D$ 4$69}D$@D$ 4$D$@D$ 4$D$@D$ 4$D$@D$ 4$ʡD$@D$ 4$財D$@D$ 4$蚡D$@D$ 4$股D$@D$ 4$j9}4 |E}<$Xu t(D$T$$< `Ee3uL[^_]ú ȬUWt D eE1=D D D Mf} E}1UtQt)$P= ݧEe3t_]Í&!u6-t;$d/ 衧ء $?= D$舧멍$8/ t$f$莩v$= M P]$\$$ @ Exؿ u U$yV  |$D$ x D$/= $|$KvU  uƀ   x D$h= $D$ϜÍ'U  8tPt $LËx D$= $D$|  ѐt&UtQt$0 +uG}U fU m]mEu2$80 迥 $= L$詥$/ 蛥$荩$5r  v$p0 e\$$ C>뒐US4tO  ܲ}E fE m\$ mD$= D$$,[]Í$$   D$P$S  D$= D$$ÉD$ ȟ  S$=` ݙ[]É'U]u  pu ]u]9tT  ǃ  -t`^ ieܯ $9$9+d']u]É$$ wiдt`^ t#D$= D$  $ڞa|`^ uӋ  p u;  t`^ ieܯ$94$9+d'D$ D$   $^D$0   $Z돍&'U  D$= D$$  D$D$ $^  D$= $YZ  t($蚧  ǁ  ǂUST1 eE10 0  1 U֋1 ]΋ 1 Eʡ1 Mҋ 1 U$1 ]ދ1 Eڡ1 M 1 fU  ]EMP\`  P$Ǧ  ǀP  ǁ  D$ S,$g$诣$D$OP$=` ݛ   $D$ D$)\  D$$lY  D$$VY  D$ $X  ]ǂd$VP$ΠEe3uKT[]É$D$D$)d\  D$$X  D$d $ ZUSeE1  8tEe3Ĥ[]Ëu$= " t$(1  $  D$m D$@ $D$ l  t# $t'$(> 訟R$> 藟A  ǃd  x  $F$WD$>> D$$D$ Ӥً!‰%t u)ٍA  D$D$ $Z  \$$V&U  ~襢~ u7  Í&  ǁ  ǂË  ǁD$O> D$  $pÍ&'US> eE1> >  > U> Eᡙ> ]> M > Uɋ> E> f]> M > Uً  E͡> ]щM1ɉE݋ddd$xID$ D$v> D$$֢$n  D$ $D$X  \$ $TUe3[]Ðt&Eɉ$UL$͜čt&uY1ǂd먉ةut v؉D$$[> I$!L$i4]]$K$J  ǂ  y負v'US4 > eE1> > > M > U> E  ]MUP$Š  ǂP  ǀ  D$ ,$e  8$螝$D$IMP$=` ݛ $J$8uA  |;l`^ t-D$D$ $V  D$> $REe3u4[]ø> \U'U$@ NÍUWVS,$eE1}$o$at$ \$$T1 D$p zٽ  f٭۝٭>  قu^ǂ=   ٟ贝 &$1 覙Ue3,[^_] w ٭۝٭9~  P u85  x D$1 $\$c  8  D$1 D$ $D$D$>   $pb  C 觜$> 袘  ,$1$耜8*$kD$\$裙$GD$\$$#=  ,<$D$D$D$$d t1!'Z|54 !+5d'sp1$譛$蟛=  D$ \$,<$D$$rD$  ,$>L$$$K 3߹   ݂ kٽ0  f٭۝٭t&p ٭۝٭* ٭۝٭$ q   ف  w  X c85  x D$l2 $T$-  8  D$2 D$ $D$D$ ? v#ǁ   ٚ$o=  <$t$ " t<1$'\$$Öu  {  u$8*>5  ~.$ȘD$  ,$$覘  D$ |$,$D$  D$3$0't`^ ieܯI$0'\$9$=$0'D$}|$$0'mrٽ fU$  ,$D$$Η  D$ |$,$D$:  D$3$0'-t`^ ieܯs$0't$c$g$0'D$|$$0'I=!'_|  !X +d'Qp"$$O="4$O"$ϖ(D$  ,$$`O"$]\D$2 D$$賍$D$02 D$薍=  D$ D$K h,L$<$  D$ hD$x $腈5  D$ (4$  $c hL$譓=  (<$D$  D$ ($  $[ h\$_  ($D$UWVS\eE1$D$D$藗;ơ  D$$BD$z|$J L$ Z\$BD$@ut< hBu>"D$t$ $:D$D$ $  xL" tMܴ=!'_|4 5!+d'Vp$j$t{  B xL$x $5? D$lD$$D$d 5'  ݁  ؋)Ӊڃe u݄٬ ؍_   ~ǂ   ݜ¬t`^ t$$m Rt$1D$$V Dž``^  DžQQ b  D4 9tTٽp  f٭۝٭tM| | L$<$fu1T$ D$m D$$9~ô Tsٽ0  f٭۝٭tixiҴ| $? D$<$uٽ0  f٭۝٭x| iʴ$88>4$,  xu'}E fEp m]mU$D$=*ݛ  D$$!*ݛD$ $@ 8  t=  D$ (<$  5  D$(4$  l`^ (D$ $=  \$(<$  X 4$  Zt (D$<$@  8(D$ $x5  $ (\$4$  $ (D$ $=  $ (T$<$5   $ (\$4$q  $ (D$ $T=  $ (T$<$65  $ (\$4$  $ (D$ $=   $ (T$<$5  $$ (\$4$  8T$$? {  D$$D$bC=  <$贗<[^_]Ãv  ] tz8t$x $4 D$by  ǁt=  (<$1($D$ =d'ه}U fU  m\$m($5  D$ (4$D$@ $ zD$  ($  D$D$u  $)B<[^_]Ðd' $ݲ  ($D$(k}] f] m]mUD=$ }?L ]؋P $U T T$MX L$E܋=\ ` D$ |$\$蟹dE؉$UT$ML$E܉|$\$D$ 诹St$ ;4_ 4   ܢx|( r 4 w}] f] m]mMs5  ^ $L$ D$$|$ (T$,L$9  p xx $? \$5   V PD$  D$ D$ ,$\=  5  qt&($D$FTEX  ( $D$<$T$ \$$L$ (D$,|$F 5  dž85  PPx $? T$$L$D$T$ L$D$O5` =L P T X \ t$<$\$T$L$ D$Y5  E( 0 =$ , 58 4 T$L$ <$\$t$D$ZY$g D$58 =$ ( , 0 4 t$D$nD$| <$T$\$L$ D$L5  ET$$A u5  $T$ L$$D$ (|$,\$F 5    D$ ($u  0-t`^ ieܯ|$ T$M$M? L$!u5  (4$D$<$D$T$L$ \$|$}`x $k? D$aVE$`3 D$I  5  5  $ ( , 0 54 =8 $D$nD$3 \$L$D$ t$|$J  ǂ8  #x $3 L$蠜t&'US  8$u$t;l`^ t$  $($P4 q[]{    H!  !  !  !  !  !  !  !  !  !  !  !  !  !  !  ! !'Y|4 !+d'Bp  "C Y n$C!'[| 4 !+ d'Jp J$膧  1҉    ǀ  ǃ  Htfxt) '`ǀHǀLX[]Ð$D$"D$ *  D$4 $&  뢃,D$? $踹8  D$? ,$藹8  D$? , $u$pD$? á  ,$S$p;̹'3  z/x D$4 $\$d  &  x D$t4 $L$Ld  ,"\  !  !  !  !  !  !  !  !  !  !  !  !  !  !  !  !!'[| 4 !+ d'Jp  "@ [ $荤 z!'Z|4 !+d'Yp$УE$D$D$''  T$$;%  D$? D$$f  I !T $]6!X$D6,"$16;й'  UWVS,  8t$5 j,[^_]$n$m;l`^ t&  $!$$5 j,[^_]w$n$l5  (4$B"  8 iЍt`^ ǃx t{t T$$s  8ôt{t;x t{t T$$Ws  8wôx t{t T$$s  8<ôx t{t T$$r~    8ôx t{t D$$r  w8x txt T$$ar  w8h x txt T$$&r  w8Jx    D$H5 D$$c  $LVp |1ۋ`'t $KlD$  D$ $#=  \$<$u!5  `'4$sL$w`'t $k=  D$D$ <$R#  \$ $!`'  T$$^`'t $k=  D$D$ <$"  \$ $ `'^  T$$`'t $"k  D$D$ $"  \$$K `'  D$$^O@k=   X F4"NtD$ $tT$l  Xt"~iشX +d'4$P$ٞdž:   ǁT ?D$' 4$6t?0   P D$' 4$ t50 0  D$D$ȿ$k  D$D$&$!=  D$ <$ !ف}] f]5  m\$m4$g  D$D$&$  D$ $t=!ه}M fM  m\$m$5  D$D$&4$U   D$ $!ـ}M fM=  m\$m<$  D$D$&$5  D$4$!ق}E fE  m\$m $:=  D$D$ <$  D$ $f  D$ ($ l`^ t$$? L$Ke  ($D$m=s(s(<ôl7h h zV@*;uTtـ?1}1U fU1m]mEx ~ ыD$xD$L$T$ |$t$5  |$4$GlT5ـr}] f]m]mE7 ~ ˋD$\$L$ D$xD$|$=  L$<$kTxـ}] f]m]mE ~ ˋD$\$L$ D$xD$  |$L$$jTـ:,}] f]m]mE ~ ˋD$\$L$ D$xD$|$=  L$<$Rj"Tـ~z}] f]m]mE4 ~ ˋD$L$  \$D$xD$|$ $D$iibؐi؉v+=  | <$pDtA"VtC8$D$D$|e  x <$0Tـ1#}U fUm]mE5 ~ ֋D$t$5  T$ D$xD$|$4$D$hI.ـ\I.~z}U fUm]mE ~ ыD$xD$L$T$ |$=  \$<$L$gc\؍vj1111~111111{11t&U  ]u}8t$l5 8]]u}]$a$G_;l`^ t!  $$5 \$`$ _ 'M s(Ɓ `'9G  t8;u~8'<;4z=s(}]`'9  D$ ( $%l`^ t$$? T$]  D$($S$_$^}p M fMm]mE T'9X'9  T$D$L$D$ 'D$5 D$$V  $fy)8D$x $\6 |$A[  ǂt  ( $  yU1U׹󫋓498+E9s(HME )498UM9 s(ȉUk8@;(t($]D$L  ($D$ L$T$|$  dR t~  @4t&498a`'+}+s(9?$oP0UX0{  릍($D$p  W (T$ $T  _$($\$;  W((T$ $  _,($\$  W(T$ $輿  _($\$s  W (T$ $舿  _($\$?  W(T$ $T_=  \$(<$   }=  x $5 t$MX  $?v  D$ ($5l`^ $? t$Y=  WJiΪT$($'L$\($}D$B褾  ](\$D$ L$T$<$S  )с)ʍA=tUt?t3t(tttA==~q($D$躽+=s(|$=  (<$ܼM  A ($D$~U  z$($|$bM=  Y((<$\$DU  B,( $D$&]  {($|$ڼU  J($L$茾}  G ($D$螼M=  Y(<$\$PE  P( $T$b]{|$  ($   D$($O  +=s(($|$q  D$( $  D$($  D$($߻=  D$(<$1  |$($y  |$( $1  |$($I  |$($  |$($|$U8]u}  8t$6 +T]u}]$X$:V;l`^ t+  $ $6 S]u}]$WD$ D$ D$$W  E苊t}}D$<  ($P}|$5  (4$u  EuE}9}. `'8]}u)߃uCEljL$( $}{9} h'c  8T]tNL$( $s请}@ h'{  8(L$s$_} h'{  8s(uL$$}^{9}|h'^  8Pu(NMωT$$賶}ah'~   8(]}܉T$$h}!h'~  8(]܉T$$}} h't  8eD$-  ($cML$  ($H9]`'19}D$=  (!É<$\$  ( $9u9]荴&9]萍t& {t&  $rD$$7 D$  $J  $mV8D$x $6 |$aO5  džt  ($ 1_]9]bv9]&9]_vU]u  8t$P7 N]u]Ít&$R$P;l`^ t(  $F$x7 zN]u]<$`R$P=8  tD$.  ($ t$  ($ d'd'u.(T$$#t  8~D$  ( $萴tft$5  (4$r8D$x $7 \$]M  ǁt  ($ D$  ($U5  4$D$7 D$  $H  $jt&US4] U$eE1T$ \$ƅƅƅƅƅnD$$NMU E\$L$MT$ UD$EL$ىT$D$!‰%t u)ٍY$`.Ee3u 4[]nPU(]u}  X4 !ـ]'[|=4 5!+=d'~p 4 ɋ$́}EM fMm]mEt]E؞]u}]#5"tN!'X| 4 !+ d'Jp $A]u}]Ít&= u!L $>4 ؚ[uEؚF}Eؚ1&5"4$AkUWVS\E  U=4 +=d'] ]  ] ]  U] U]BU.v K|(  ;4 Cx]ك]C|]ك]E؛E؛ @ek,   NV$YF(ك tvF NFVNF V$E;EHXM;tك Ct}Uζ fUm}m΋Mw+m]m΋Mȋ`'F u$<8 Sv$8 @Ct}]η f]뵋Et)DXw%]D[sMQ U\[^_]Ë}GhuɐUWVS=8 ^=8 2< F@ V D N H ~=L wN4 Q$٘p^=4 $$ٟxV 4 $$ٙt t ~3FX  ݃ v 4 ǁ|ǁpF- FB=4 ؟u-FN4 =4 V =4 ؗ,s!؟LJ=4 S$   ٞs ؋  UЋJه]ه]ԋه=!] ٟ!'Z|4 !+d'Ap= M$P{ t=!=!}EM fMm]mUt]E؞4 $  =4 ]ه% ]ه% ]ه% ]E؇ E؇ E؇         " N " V" F " NEЉ " V$" m ه}}M fMm]mU # L ]E- 5 u " t\'$   P  50  T p $$ P }5($ ,$ U=$ fUm]m] m]mu=0$  m]m]щ4$ =8$ ;5  L  4 4 # ٘=4 # ٟ5# F54 ن}] f]m]mMQ$ٞE- 4 ٙ4 E- ٚ54 E- ٞ =4  4  54  =4  4  54   xt}<[^_]- F4 fW$ٚ|- ؏ٟ=4 =4  }=4 D$<$W" _1$sP9=" 7k4" , ${EȋtΉ։)PuUȋ !+d'Qp4 !+d'Bt _Mȋ$C N4 ك}U fUm]mEP$ٛ54 k=# , $+d'(VǀGF)   =!O$\8 i$@ ^D$ D$K D$a $@ !!!% m]mE!H $ 4 ؚEؚEؚ4 )Љ   UWVSE$U  ǂǂXU ?4P!QZ؋U ;] ?<ݜP?DŽX  X ' 4 8ݛD ǃDž4$ yt*w&$HD $8 m$8 5}<$Sd$9 : :B :J :Z  ݂ $R9$J;  x $A@ t$_=  |(  ݟ/Y !'Y|=4 !+=d'zp8~"W$["@"B(="G4 "A@"@L"BX "Ad8"$W"Z$>l"$8$;N"$7($3"$74$"$7@$"$v7L$"$N7X$s="$&7d$K ty}<uم@``^ t`^ DžHt`^ |;DžH(6d H@A Hƴt`^ H|Ht`^ |uh Ht`^ | Ht`^ |VHt`^ |,Ht`^ ||8#Ht`^ |n(Ht`^ |.Ht`^ |T4HHt`^ |D;LD$@ H,4$x$1\$$v/=  D$09 D$<$(5  D$d9 D$4$(DžDٕ@S5  <$a2  ǁ  ǀL$@ \$W  dlD$/L$B.LtPT$ LD$9 L$L$PT$Tt$X|$ \L$`D$D$9 =  D$<$'  D$d9 D$$'oD;Tt8̭.D$@ $w$!0\$$-H=  x D$"@ D$<$D$ '-$/  D$G D$ $D$ &/9|ʡ  D$ D$$&=  x D$2@ D$t$ H$&$G/D$G D$D$ H$U&uD$ D$H $2&D;Ld#D$@ $u$.\$$e,JD;T( $D$@ ju$|.\$$,VL$w@ L$T  D$D$ $5  D$= 4$LgD;L,$D$@ t$-\$$s+ eE1=> 5> > U > >   }ۉu߉]MEP Qق\`$hD  ܢܲٽ f٭۝٭  tt ډ)9~Ӊ\$${A )=  P\$D$<$t$   `Ɖ\$ \D$$A L$b)  FD$D$)$  t$ $  `  \Q$u苐`ٽR$  f٭۝٭d19>\$$A (  \$$t$5  |$4$R    `;\Ee3|[^_]Ív=FRFHt&&$D$ D$ D$$$VD$ D$ D$$~$(D$ D$ D$$Pt$\$$vP]ۉ$5  džP  ǂ=  D$ O, $`$$D$P$=` ݟ$$k6w  |;l`^ hD$D$ $=  D$> <$5v9cdst&'UeE1]u}t)$A Ee3]u}]$D$/D$\X$&nX/t    uHD$D$)$  D$$  D$ $?X4$$D$) D$=  D$<$  D$$X  T$$4XD$ $X$~?X :Gwu( :Vu :Fu :V.  ٽb b f`٭`۝\٭b\nXA (х҉Tu& ٭`۝\٭b\ XA (Pu&0 ٭`۝\٭b\XA (х҉Lu&p ٭`۝\٭b\XA (Hu& ٭`۝\٭b\6XA (х҉Du&0 ٭`۝\٭b\XA (Ѕu&0 ٭`۝\٭b\p ٭`۝\٭b\u:Tu0Pu&LuHuDuDXD$/$&XD$A $   Pta$55  džP  D$ ,$Z=  $'$D$GP$=` ݟXA ud :SXA /Xt!XƋËu  XD$=  $P  Ptnٽbp b f`٭`۝\٭b\tX$A \$k9  P4$\  ǃ`  P $MTXA uF t<ٽb b f`٭`۝\٭b\q  D$ ,$XƉ$8-     A Xx D$$B T$M8X5  Xۆ\ ɉL$ D$1B D$4$\$ \$= ?X\$$=  D$LB D$<$S   \$D$gB T$ D$$(FvsXD$D$ \$Q~XPL$<$d\  x X$A T$D$7  +X<$zXp0e<$h~/.tt&1X|;. 9u$XXD$v> D$\$ p$Wً1!%t u  )ٍy|$D$ $4  \$$XpT$ D$W D$D$$XةtR؉D$$[>  $譺$   $;    t 륋  P4$=  LJP  N5  Xۆ\ ɉL$ D$nB D$4$\$ \$wX<$l$D$) D$  D$$W5  \4$L$?X  T$$4$=  $D$P$=` ݟUWVSEU ƋM~MMvtotTt9t}_Ms]G1yZڄuOSCOSGuOCSGuOCSGtluOCSGtUuOCSGt>uOCSGt'u5 u+U [^_]BÅtt&'U1ɉUS] 8u[]Í&UWVS Uu] %>B<t\9tKt>t1t"tt9tx9tp9th9t`9tX9tPA98t>9t6xHt-xHt$xHtxHtxHt xHu)Ɖ)tB} 1ttu+} 7 [^_]Élj))uU $C [^_]É1띍t&'US]$ H@'t&1 t&4DrDQuE [^_]C|Ek`CE [^_]Ít'ځv |#E [^_]ÐUt ǀ@]Ð&U]   Í'U1St(1A߃ӄu )[]Ít&Ud]ÍUE9dTI ]Ë]ÉUt]É] É'UB< v$-t+t 1.t]A<.t0< w]ÍA]0<  UWVS,D$  $m UD$ D$D $D$/]丩 ;tR1vE$D$qAt$DL;ue[^_]Í&UWVS,D$  $ `UD$ D$ $D$Q.]丩 ;tR1vE$D$@t$mDL;uEe[^_]Í&UWVS,uD$  $ UD$ D$ $D$-];M :t$D$  $ $ ;1EEE9)1\$D$$J E  :t S@U܃EEL;ttt$$?tD$ $,)؃\$D$$A D$  $% AEEE&$ $  :u;E \$}$D |$me[^_]E e[^_]RE \$u$ t$2UV1S@tC$ D$[ut$$D [^]Ð&US$$G D$9|$ []Ív'UWVS$$ eE1}D$D D$PD$<$D$  D$D D$$>\$$D D$ $ |$1D$ D D$D D$tF $@t3C;CtD$ KD$D 4$L$r[uӋ` Dž t6{x)C;C t!D$ D$D 4$D$/ [uʉt$ 1D$D$$E HL҉LLuDJJ,J<JLDR\҉LLyBD$JL$ D$$E 4$\$LLJ tBD$Z\$BL$ D$D$7E 4$\$KLLJ]Z(\$B$D$Z L$ \$ D$7E 4$L$ LLJ,&B8D$Z4\$B0L$ D$ D$7E 4$L$LLJ<ZH\$BDD$Z@L$ \$ D$7E 4$L$LLJLBXD$ZT\$BPL$ D$ D$7E 4$L$ILLR\҉LL 4$\$|$T$ D$F  4$3 \$ |$$G t$ LLEe3u[^_]É\$$B ]t&US] D$E$Ñt@9~[]É[]Í&'UVS@uu -[t&C4$D$uM 9Kƒ[^]Ã1[^]ÍvUVSuu #tC4$D$u[^]Ã1[^]Ðt&UVSu4$=7u+t%C4$D$suU S[^]Ét$$DG 1[^]ÍUWVS,E eU1ҋuDžDž+n"$98t?R<"_<$9<"@<$hVք<"<$3ABrti<"<$y3rBt6<"O<$>r3Ee3,[^_]t<"<$Pw!1ƅ+<$t2C $]tǃU9t Ѓ wʅ_$ۉ $=)ډT$؉L$$$qÉ=1ڐȃDuˉ $ˉ<$=%)ٍL$؉|$$$ÉR .TC6.t&M Ct&ct&'UWVSE$Et<=@t>&[t,st$U$/u[^_]1[^_]á`EtQ[tFst$M $u[^_]ÍEwD$t$]$tu܋uu늍v]KɉMvuUT$t$}<$;uGv'UuE ]u} Eu.4$&}t:u EG ]u}]w&$tG 44$|uƉDžu 'tK4$L$uu EG $NpMH @ PP5@p@]u}]Ð&UD$@ $RE D$p $WE D$` $vE D$ $\E D$ $aE D$ $iE D$ $tE nD$ $|E ZÐ&USMU E  T$$( []ÍUWVS|}eE1` ʃ w t"ʃ vt&/_]GJ$4$D$;=tÅƅD$E $+փ$dftSvt(D$E $J$_fD$E <$&$;D$E <$$9wt&D$E <$$wD$E 4$${D$E <$$X~D$E <$e$5z~9f E :KE :C=E 9u E :Cu E :Kt&5E 9uE :Cu E :K=E 95 9P=E 9u E :K#5E 9uE :S\E $T$D$D$dfD$E $+Ӄ$tID$E 4$$h#D$4$<$D$n90D$E 4$~$ND$4$Q<$D$D$E $,$tID$E 4$$D$4$<$D$tmD$E $$tBD$$<$D$H9tT/<$D$E $L$oD$D$ <$*D$D$ <$\E :C6$$$ٝ$rم$4$;$ٝy$!م  :K$?$$ٝ%$م>D$E $$UvS;b_9Kƃtl$D$<$D$Dt;$D$V<$D$$D$"<$D$9tD$D$ <$4$sD$<$D$4$sD$<$D$^u~D$4$-$D$j<$D$D$D$ <$D$D$ <$D$D$ <$eD$D$ <$ E \$$E $,H :D$D$ <$OD$D$ <$2 E :C$Q$$ٝ7$مP E :K$$$ٝ$م$$D$$D$D$ <$Dv'U(E }}]uE$E싗@=@@E)=@Ee@+uT$44$D$M@+@L$U4$T$@]@]u}]EE ]u}]u t$] $\$U@뱍UE$ D$Ðt&UV1S]d< < < < =dts$tydOw)T$D$` $ $` dt0< jW$hu[^]Ít&'UWVS D$E$$#u [^_]Í&Džt25t#S4$T$uKt [^_]"iut?5t1KL$4$~u$ s(u [^_]omH$k$E D$['UVS5`t^F($h4$^u`1 u[^]É'UWVS }=Et1 ޅtsÍC|$$:utz `tV1 CޅtIÍC|$$utW{~S($M$E [^_]à 1[^_]$lH  1[^_]Ë U ys5`뤍t&USt$H []$$w"$uӉ\$$F ft&$E T[]Í&'U]]u$a$$L\$4$D$q]u]Ðt&UWVS,eE1d$$O4u6^|$$HuN( $D$ |$$ƅ+Љǃ$D$ $D$\tat.$D$<$D$G$D$ $D$T$D$u<${D$$90~D$D$ $$D$$_D$$_D$$D$$D$$_D$t D$D$ <$M$E |Ee3,[^_]$)F U`tϋS(CD$$BF T$1[u묍$F(뙍D$D$  $D$D$ $$,C`Pƣ`^44D$D$ $7D$D$ $v'UWVS,  E @ +]MyӃ<$8}potetJt0tEfX$t0U  $t0E$t0U  $t0E$t0U  $t0E$l9}t0]$QU\0t4$>t]D$+\0uL $t]D$U\0t4$t]D$M\0t4$9}t]NVU܉$ǃ=  ~PM܋@ L$<$D$  9tED$ <$D$9  ]܃$Eu1 ;E<+uP -+DUE+t-tۍ@u捴&U܋EL$T$$7M܋UD$ L$$E;EhU:u"<$qu4$f,[^_]ÉΉU돉$WԐt&U(eE1]u}t)$H Ee3]u}]D$$4$D$S 4$K{t9^t$<$ &$^$eF D$NЉt$$LF  $zu$"$SF D$0&UWVS,EeU1Dž@@9J)‰ƅh11Z"u ; 8LtWt*V1"u ; 71ۀ"u ;e 71"u ;= 9t&71ۀ"u ; d_13߀"u ; :17"u ; T31{"u ; {9Q|$Ét$ $GƄ= ; @@5!tct_\$$H  @ǃ@Ee34,[^_]Í<$맃|Ét$|$4$Ƅ= G Ƅ;LJ@ LJ@ t<tl1DžeDžQDž=1Dž,ƅ1F'U$ ÐU]d $ Í&Ud ]Í d UQ;  ]d ]$ Ív' d UQ;  ]d ]$ Ív' d USY; ! ffDd []ø$ 'Ud t$$p;5 8  QAQ5d $t$]ø$ v'U1҉ ] u5d 3CKCҋ] ʉ5d u ‰UE]Í'US1=t@vvƃ[]Ít&US1U=t@v tvƃ[] UHP$ XI ]É'UP$ \I ]É'UP$ `I ]É'UE@@]Ív'USE` u[]à t t t tt]/ux/utπ uȀ"t@1Ɂ ` t t t t u[]Ɓ` [1]Ã1"t%u!䈓` "uۄƃ` 1)&U1Vu S]  )E19ã  2H2ȉ  9A9ã  A9ã  A9ã  txA9ã  tZA9ã  t<A9ã  tt0A9ã  [^] @         # 1vUWVS1ۃ`ME )`9\مV E1<\,;}#UЍW<\;Ut&t\t<tGW<\t<\Y<\>g<\#L<\1<\<\;UYr<\CVK<\FCVK<\tuFCVK<\t\FCVK<\tCtpFCVK<\t.t[FCVK<\ttFFCVK<\.AY<\tt <\um tt Kv1[^_] U1҉Mt&1%Bu)]Í&UEWUV} S~EHGd;u_StotSvt4tCf_CCCCCC;ut{KB„tlKPt_HKPtQHKPtCHKPt5HKPt'HKPtHPCt ;uu[^_] U(]]}u$螽NjE $葽u؋u]}]Í39M tυt18E шMEv3tWu94uu CE}t*M CQ ; uA;t>M]1AU(]] MuUuMCL$ 4$T$D$覺D]u] UUVu SJNBFZ ^ JNBFuwt&u^uIu4 u@tTFL[^]Í;F؍kfFt&[fF묐t&KfF뗐t&+^ |v^gv ^OvUheE1E]Muu }] i)Ӄ< ~<UL$$t$M2 L5GMD5]2_\5W~|$ $T5hBUe3u ]u}]&UE@@M HUP ]Ð&UWVSUeE11:\;<\t<\ut&)|$$G ;CS<\t|t<\uӀ:t$$ 莵;YEe3uQ[^_]É1Ҿ)։t$D$ $跻ƅSv$dI *諹vU1WVS,MeU1ҋ]} )9\ Ÿ\z9`]؃\-;! t&titHt&t#\\f\J\.o\S\7\;Q^щ<\BsJ<\CBsJ<\tzCBsJ<\taCBsJ<\tHCBsJ<\t/ttCBsJ<\tt_CJRs\&QY\tuXD$T$ $衶t;tKr Ue3F,[^_];sփO\tt;stitFt%\0(\ \\\\;SqӉ<\yq<\^VBNZ<\B:FBNZ<\%FBNZ<\FBNZ<\FBNZ<\FZRN\ &މ|WO\|t+NUWVS,E eU1ҋ}D$\$԰$sI xMe3 Y,[^_]G_<\ubSs\D$T$ $p>t<\tpu9S<\m1;%SNΉ<\BBqZ<\&ABqZ<\ ABqZ<\ABqZ<\ABqZ<\vABqZ<\YABqZ<\x$t$\$ D$I D$<$艮!‰%t u+;Er`|$}T$ t$\$|$$J D|$Et$ D$|$L$\$$,J 諩 t&҃ ~uUWVS,E ]eE1;\t&<\tt<\uCStt<\tht<\uӀ:*uD$ t$|$$nEe3u,[^_]Í뢃:t&USU ]ME:*tEMU ][]hEI []:v'UWVS,]U eE1}\T9@\9vt&tgtDt#\z\^\Bq\&U\ 9\\9SNӉ<\BqZ<\ABqZ<\tvABqZ<\t]ABqZ<\tDtwABqZ<\t/tbABqZ<\ttMAZRq\.\tu@8X;Me3 ,[^_]Ë9s׋\tt;sthtGt&\:2\\\\\;SqӉ<\{<\h`BNZ<\LDFBNZ<\/'FBNZ<\ FBNZ<\FBNZ<\FZRN\ \hƉzD$$V\TLvct&'UWVS  E&=@ EMW$YT$8f;ut&tbt@tG]D$$ڣf UL$$輣~]D$$蟣a UL$$肣D]D$$e' UL$$H ]D$$+;u UL$$^U މ$L$E$T$ɢsM $D$謢trsU $L$蓢tYsE$T$zt@sM $D$at'sU $L$Hts;u!1 [^_]Ít&UWVSM u` &؃ ~Iļ[^_]Ë]$CD$U$ 9CvD$ \$M$U L$1҃¸T=X u_1l\ƅu tS XT$C$`1t* t%tʋ\ X\$L $_1Fvut U5]3 X_  ̉MK9 |D$ $:£|?u 71|1ARÞAR؞zy z AZBAR؞7 y z AZB9|dY`zAR`1AWžFS؞F C NSWKd`ARÞ1)ll XP]zPMK%I$k94Rx4$D$xƅɉ WUA1;>KNCF KN CF t*fSVKN CF SV KNCF SV KN CSN F BABA BA BS8A C8NFBABA BA BSTA CTN$pF$B0ABA BA BA CFKN SOV CF 9xPll5XO((uMKM5ME]ÉuEU4GQ4ҍC QҍCEC Q4ҍCu9uhq\XAMCV ҍXB \QҍvXAhNU1U4sQҍDҍRU41҉ll5XOHHMC7 {D$$=ã#MW10AfCqfstbt@t&tQfA SfC QfSTfTDfDDfDTfTTfTDfDDfDTfTTfTDfDDfDTfT9TfTDfDFTfTTfTFTfTTfTFTfTTfTFTfTTfTFTfTTfTFTfTTfTF9TfTTfTlBPllXpXpF?# vumUa } uT= 55S4EE jBBBBABABBBB‰BBBBBBBEE9E@ٚҍ RUiMҍRz؋ =ˉ}MD$$5MF=$ 0at~tdt&tFt,t=f $0$0$0$0$0$09$0$0$0L$0$0$0$0\ 9މ$0eU:]5EuES+UỉSx +UfifLSx +UfifLjPS+UỉLSx +Ufi̋PfLTQx +Ufi̋PfLS+UỉLSx +UfifLSx +UfifL9uT;5 lN L H4$Eȣ@_lX ]~ Dž҉}̋ ȋ HEEp]@C u̍ZFGtatQtBt4t&tt Gt'BBBBBBBuى-92pL$|$Uȉ$l HEEp ;U~DM-9뢡H D$D$Uȉ$yu D$@]$\$[vļ[^_]ÅAS9'tntWtHt9vt'tt ƀƀƀƀƀƀ9ƀƀƀƀƀƀƀƀ9uq$0L GEHU$0L 0D$$5XPlO7$L$t$蝃$0L K?$0L K\$$L H $? @ɉ]УD-E5Ht$}Љ$|$ H҉Ul L @EUEMM؋u1}#U1tEԉt;EUEMҍ4E P}tctPtBt4t$ttV       9MtQ A A A A A A A 9Mut&E}9}Eu95 LvEED$0L $_L ~cҍ4RUҍ4RU$LL _}=K4 D$ U D$D$L $L  ~t&USÃ&tMCPwL@ v3s=tPC [u[]Í؋[ 뙉D$D$$͜tރt=u+ỉ 뗋 ; t+iëA[]ÐUUMVES] uUQQK St[^]UWVS u] }xP9^;^ ~ $XU  VB<w$b ؞r2Yy [^_] GJGJb ̍&Yy&UWVSÃ\M;h;lx45`dC<wbC U ruFE \$E$Md\[^_]$U ЪwCCC ̋EGGHHwK ٞ؞sE GeMWU]EE]EԋE]GMЋM@U]GEA]؞EʉMDN\$EM$]HuT\1[^_]Ãt1\[^_](E̍M܃EĉL$LF$`L$+EtG؋]čUE D^\$E$M8K |5&U̅s5ĤK ȤC ̤Z EUԋuM]]]]E]EE]ȋhM܉L$$`\$]%Ez؋U1u}E5=(CĤCȤC ̤w؋EM܋]Eȣ $wL @1FU 1WVS U?] =uJ B `CdChS lK pStK xS|K S$M|$$U3 VF=~ ^ NVF=~ Ĥ^$ ȤN(̤V,ФF0 [^_]UEf]ÍvUWVS] E}$ ;UMs1_f3U ;]tytZt;t_1f36U _ 1ωf3?U ;1f36U  1ʉf3U 1f3?U  1Ήf36U 31f3U ;] s1Kf3U 1sf3?U 1Kf3U 1sf3?U 1Kf3U 1f3?U S1΃f36U 1f3?U ;]EfME[^_]ÍvUWVSE}] u MHE 1f3U f;utntGt$׋] u KÃ1f3U f1f3U f1f3U f;utm1f3U fN1f3U f^1f3U fN܉ƒ1f3U f;uu[^_]ÐU1St(1A߃ӄu )[]Ít&UD$P$ D$@# $W ҃D$) $W 较D$P( $Ur 誃D$0. $W 薃D$1 $W 肃D$8 $W nD$P2 $W ZÐ&UWVS=Et`O7$W ʉȃۃ㭃s҃⫃u*t$\$ T$D$oEu}$W |$o[^_]Ít&'UVSu^@u [t4$D$uu[^]Í&'UE$t @Í\ É'UE$ot PUnÍt&'UWVS }@E1&CޅÉ|$$Ktu߅CFtb1vCޅtRÉ|$$tutb{~K $Vt$Lt$Dt [^_]à 1[^_]$ X 蹟 1[^_]ËKU @ls5뙉U}}u]<$6t]u}]Ð$$j ƉHm@V<$4@q$iÉ<$uq|$$D$cE $Wq$iF} É<$$@ |$^$D$mtD$ \$$@ \$zF]}E uU] |$4$Ѕt n  'US] ;u []Í$mu$D$ $ []Ðt&$hm~1}[]Ít& :t$Y Ii놉U]unt$X j]u]Ít&$n$Jt"$n$D$]u]É4$jwu"$znD$4$D$놉t$$5X Tjq U%nt$DY $jÉ$n$t0K XtT$ $+ú^ T$ $$m$HX D$iÐ&UWVS,$eE1m$1Zmƅ+щ΃$#mD$<$D$a~D$D$ <$atmt<$lD$<$D$a~D$D$ <$la$lD$<$D$Mat&$sulD$<$D$a9~D$D$ <$`$^+lD$<$D$`~D$D$ <$`$^kD$<$D$`~D$D$ <$~`$^kD$<$D$_`D$D$ <$>`|$4$Ue3u1,[^_]ËZ\$$_X D$&gkv'UVSPuE ]eE1\$ D$ D$ $plً!‰%t uȃ)؍PD|09D|0twt_t&tCt+tD|0D|0D|0D|0D|0D|0u~BD~p|0uiD|0uZDP|0uKDP|0uLT>ؚ-xT$$X \$}]X ޹uq$X []$Z O]$Z C]$Z 7]$([ +]$P[ ]$[ ]$[ ]$\ \5$@\ \$Y \[^_]ËTؙ(L$$X t$\Tؙ#L$$X t$S\bT>ؙ-H,L$$X t$\TؙVL$$X t$[TؙyL$$X t$[TT0ؙ, L$$X t$C[Tؚ, L$$X T$Z$X Z[^_] % :J% :B="G@@5"F?$Z Z$4Z Z$Z wZEUVS$\^D$ D$ D$$^$.^D$ D$ D$$V^]~WS$t- "V$Y"Z"$$[^]$4Z Y$`\ Y$`\ Y[^]ÐU  Mu]áĵt*  tu9t׉‹u]1Ð&US$\ -Yĵu'QT$$W] D$Yt,9ȵt*uʉ\$$ Xuԃ[]$g XȍUVSuFt. Ctr[t&Uuu]}} D$.4$s\tgD$/4$mXtP)ӍC~+=D$T$<$lM]u}]øD$D$\ <$@M҉4$Zv뉍&'U]]u}$NY$D$D$TZ$,Y|$$D$6Z]u}] UWVSEM LHeE1ĵ  ҉XXP"TPLT1L$X4$7WTfHDžD9D>tWt+L^H$L$VDžDfL>$T$VpDHL>$L$VIDHT9DL > $T$]VL_H ߉ $T$;VL{H>$L$VL>$T$UDT9D_XX& .ٽbp b f`٭`۝\٭b\L$\ t$7~ٽbp b f`٭`۝\٭b\PD$= $YHPPD$H\7@\$$VPT7D  ЋUe3:[^_]ËLP$\ L$t$B}LLpX$D$W t$\$ D$XpD$= $ YH,ٽbp b f`٭`۝\٭b\tp|$$A |H$G£ P$\ \$襃LD$ <$:!&V&'UWVSueE1h] D$4$!hDžD҉@ l|$4$S$ ] ̂DžDt$$] 貂@1DDžHh $R 9@hD$D$4$D$ S+HP~Cٽ^0 ^ f\٭\ەL٭^L~ c@؁ߍh$ZQa9@hD$D$4$|$ >S+HP~Cٽ^0 ^ f\٭\ەL٭^L~ c ؋h<$PhD$D$4$T$ R+H=P~Cٽ^0 ^ f\٭\ەL٭^L~ c؁)@Dh@D$4\$ L$4$Rh4$SUe3D-[^_]٭\߽P٭^P$*uH٭\߽P٭^P$tH7@;е=̵DD٭\߽P٭^P $tH@$褫D멋@D$|$ $诮D넋@$Dh$ӭDUQvUED$$Ðt&UU E̵еE ]o UED$$GÐt&UED$$'Ðt&US] D$= E$;StE[][] UWVS1ہ<EUT$$]MD$ D$ $\$ O}PACKtu$#] t$}E=\  $NH}D$<$ED$Ou]D$ $t$ \$OD$@T$^ $AF@ $~DHDž tH<$dD$@D$PA\O@`GDDžǐ<$D$@ D$@Z8_@r<@wDH<$D$@4t$@K8O@C<@GDH9<$D$@ D$T@q8w@Y<΃@_D_H$D$@($T$@N8K@FyZH!}h !d ϋhyZ M!ω!\ ϋMyZ}UU #U!#} ʋMyZ] ]!! <3yZu} ! ΋ M>yZ!߉D !@ D9yZ }!!8 yZUMx} #x! ʍyZ]0 x#x! ߋx7yZxM}! #u ދ]>yZuMMx! ֋M#u#M ދ] ]>yZT! ˉyZU}111ڍ:n}$$1э9n ދ 11n<11 n11 n 11щ9n11 n H11 n11 n1ى1э9n}M1׉1ύ7n||މ13|03nˋ|ll3|3l3lln11ʋn1|ln11 nxp PED$@D$$9 [^_]Ít&UWVS,M U}MUG?9‰GvGuwE@)M]9]s9E1ɉ}}U)U]NjE}]ȉE ,[^_]7wˋMuL$U$T$7UoE?9Eruu]+]uUsAE]M@@9ME(tntYtBt-tډU]ꀉU܃뀉ډ@E@ډ@E@ډ@E@ډ@E@ډ@E@ډ@E@M܃?9MvyډhS@^QD7@*EE܃?9EwM1-M1M U(]] uueE1}}S.C?7wp8)‰T$D$ $eD$t$$QډD$XD$$6Ee3u]u}]Éx)4Ux]]eE1uu}}$5E t$$D$\$<$Ee3u ]u}]P4&UVSĀu]eE1$M t$$L$\E$\$EU3E3U1ЋUe3u[^]3U] U]J@ Z8Í'UU$t]1]UWVSL}WT$G D$w$$ t$ _(5( \$$O,, L$(W0 0 $8 t$T$,4 \$L$ D$T$,u L1[^_]jk}k&kMU]}E fE m]mM_H9wy}U fU0 m]mEjW$G D$O$L$W(T$ G,D$O0L$\$ t$$d^ D$-L1[^_]É)ٍYۉ_~rG}U fU0 m]mEtKW$G D$O$L$W(T$ G,D$O0L$t$ \$$] D$%-t&];_\tuwHEGLMOPuuY^ 1Ҹ_XO +]RS,$^ _ O gG_ _L[^_]ÃwTLJ$|t&  L$U\$ T$]t$$] \$d,? UWVS UeE1uXݕFh- r8ٽp  f٭۝٭tJ~<$^ \$N$L$F(D$ V,T$~0|$x$^ D$+݅Ee3 [^_]Ð؋VLDž ;V`$ :,Dž0Dž4^T~X ^HW ωVX|$$<$ې\$<$ϐ 40);E ^XN  ݜT L$V T$ ~$,|$F(4D$^,\$N0T$<$L$ F8  ۅ4N@^8't  ^8ٽ  f٭۝٭p4 T$~T|$FH\$D$ NX$-^ L$)6NtkFx(L$D$$.Vtv\Ft$Dž 3t&^P;^\ $ۅ4N@^8] <$\$L$ 4Kt&$(\$<$T$NXN`\-t&UVSu$B,eE14$Dž8Dž<D$qE t$$D$~MU EuL$]T$ MD$4D$ D$ D$$(=C w)D$_, $ +1;[]Í&1[]Ð&U uAD tH u< $%Ë  $%< $%$%뵍UWVS$_ |$SEfUe3<[^_]fE1$ ~5 ]D$\$4$6&uet&#É$#D$$X_ D$R @ |<$%E$$$_ D$ u#É$9#D$$4_ D$R>I#Ë$ #D$ $_ L$oRj%t&UWVS<}eE1ED$D$$N'<  < uD$t$ D$D$ $#%t$5< D$!T4$Q&fE$^ }tp;5  KEt_$ ffU|u[=< D$<$"Uf‹Ue3x<[^_]Ít&fE$ ~|t=< ED$D$<$$u< $ !É $a!D$3$` t$PIq!É$5!D$$` D$P < $j 5!Ɖ$ D$$` D$[P@ L $"E$k!$P` D$S É$ D$$` D$O Ë$g D$ $$` L$Ow" UME @@@ fQPQfP]Í&UVSu MteE1 $\$U D$\$D$ T$t$$ tEe3u=İ[^]Ë t܃ot׉$hD$$` D$G{!vUWVSu ]peE1D$D$4$#ffFD$\$<$wcpt6 t&<:u$ffFuߐt&p0< v/<$"txt-1Ue3u.Ĝ[^_]É<$ FՋxVs t&'UeE1Eut]] t$$1҅t\$4$ЋUe3u ]u] v'U(EMU D$^ D$E L$T$D$@D$ $ Í&U(EMfMT$U D$E D$^ L$T$D$ D$@$@g @Ð&UWVSuX}eE1DžTEEEEEED$D$^ $D$$ƅW|$$N T1ۍXT$|$$+<$t$N~uU܉Vt-$^ Ee3ļ[^_]Í $VT$~|$F D$ ^\$NL$c$^ D$s렐|$$^ 5|$$^ [Ë$D$ $` L$J t&UVS ]u $(tD$$T$_ $L    $ :L T 5X \ $P ` \$t$ L$T$D$K$ D$諴E_  [^]I'UVSeE1 ptT$Džp\$D$ D$ D$ $D$$ $5 5 tUe3İ[^]É5$ , 0 ( 4$4 58 L$T$ D$\$t$A$a D$Q11 tZtF't-$D$$\a D$H E $ ( , 0 $54 8 T$D$\$ L$t$$8a D$4(10&US$ $ ( , ] $ 0 T$4 D$8 L$ T$D$D$_, $D$ D$ D$$pD$_, $D$ D$ D$$2CD$_, $trD$ D$ D$$CD$_, $Pt7D$ D$ D$$C D$_, $$[]ÐU‰S" @;" C1Ƀt;" tjtYtHt7t&t;" ;" ;" tv;" tj;" t^;" tRA9tN;" tB;" t9;" t0;" t';# t;# t;# t H;" u[]Ã" " []Ð&UWVS U Muz}B]uMAyɉEZAJIM& sq /VvL raɋMU Vٞv r$E [^_]Ð؋E [^_]ÍvFE [^_]ÍF떐t&it&U‰= Etn ua  J Jv8D$  T$M s\$$ Ít&UST    M]  Uvn# ]# #  $]' 8$ u # t= t =# B]Ë8$ t # ]t؍U]$\$D$ !UME܃E]؋E#   'v  # # $  ]&a  # $]&# ' MɋE# #  #UEUЋ]ԋM؉    !'UWVS1ہ ٕL] ٕH] ٕD]ٝ@Dž8Dž<م@uЉt$ \$D$ $ UЍMT$D$ $E}Eٕ4؞vu1ۋUM5   م4( _EE' 0<~U<[Msٜ/h/`/d1`PPUD$ ?D$ $\$^1Ʌ   t)م`مdمh؞lYtjvt9t)مlمpمt؞x9tBB؞j 9tBB؞A 99tBB؞Y9߉ٍB t B @@؞9ύBt B@@؞K9ύB$t B$@@؞K09O9مL  مH  مD  ؞*88م4؍@ٝ4م@إ4ٝ@9vP 99d`M荝lL$}\$$D$ <$E  E  E  \$uK< t$مL مH مD MЉL$ $\$G $ e BuЉt$4$\$$ $ M U}D  U]  U]  U%a ]ɉL$T$<$ٝٝمم]u$ sO!  O  & MD$ ?D$ D$$  ONU]]uu }}ErkɋEv]u}]ËEA@CFr-BGɋE@wAMACFsBGɋ]C돍v'U1 WVS8 ٕHDžhEu]U (ٕL~,PKTr]]] (U 4Br]]} ,M 0Aq]]5 1 t&K׃L~+GD$ GD$B D$E$UG% G% G% CCCM 40M]㋅(]ዕ,]M]E]lL$ $]ٝٝٝD$|$xlpم|EEEمممiͺؕH4ٝ|ʋx̋|pn|]3X4x1 1||11nE3F8(^ 1$$1؋|(C13|(0n|u3sUWV)Sà t$<$D$a L$ CVOT$ $D$ D$a CVOT$ $D$ D$a CVOT$ $D$ D$a CVOT$ $D$ D$a CVO T$ $D$ D$a nCVO T$ $D$ D$a LCVOT$ $D$ D$a *CVOT$ $D$ D$a C VOD$a  T$D$ $[^_] US]$eE1OHUe3u$[]Íct&'US]$[]t&'UVS]ueE1]$ڍ]Ue3u Đ[^]ÐUD$@$ $ $a  Ð&UWVS\:=0b 1D$D$a <$REEfD$D$a <$ E:fD$D$a <$WEYfD$D$a <$,EwfD$D$a <$EfD$D$a <$tEfD$D$a <$IEfD$D$a <$EfD$D$a <$tYEf D$D$a <$t2E/f D$D$a <$t EMf O $3ÍG$&U -mim9ƒ)ȍ\t\-4\[^_]Ã~r5\ِUE@]ÍvUEHH]ÍUE UBQB ]ÍUE MPQHA]Ðt&UWVSH ( } ˃$ V ( $_F$T}MGUEMMUW'Agǃ$ E V}MUUԋUMЋ}E؉EE M܋UTЉMčMЉUȍUč}E\܋]ẺT$L$$FE܉|$$D$F H[^_]ÍvXt&F Fǃ$ H[^_]Í&'US]CtS$$CC[]UWVS]DžlDžpDžd$ M>dQ9rhؖh؟hC؞w}hC؟wiu h_xrVhF_|rEFh؞r1}9pphE4p&R95؋dt\u GspwltlMW ɉddltUlltdvϋdQ dddxdP؋pĐ[^_]Ð&UMU]] uu}}r|EAEABC^EB@_BAEBs>C^UAB_]u}]E낉C^]MA_뾍C^EE@_pUD$D$$$ \'$( B D$T$'Ðt&U\'ML$B,$$D$CÉ'UWVS\]uD$D$CxD$ t$T$$BljC IPfK+t|t&tbtMt8t"t FfCTfTKDfDKTfTKDfDKTfTKTȃfTK9TfTKQDfDSQDfDSQDfDSQDfDSQDfDSQDfDSAT9fTCx\[^_]ÉUWVS<}D$D$ GxL$T$$Cs9tf1ɍY9tWt)9ttؙ9ttؙ9t{tqؙud!Ptpp+d'Pp!+d'Pt!'X| E !pp !qt99ttؙ]9ttؙ9ttؙw9ttuؙuh!Ptpp+d'Pp!+d'Pt!'X| !pp !qtt&9<[^_]á!Ptpp+d'Pp!+d'Pt!'X| Sy!pp !qt!Ptpp+d'Pp!+d'Pt!'X| !rp !qt9!Ptpp+d'Pp!+d'Pt!'X| !pp !qt ؙ!PtXp+d'Pp!+d'Pt!'X| ?,!Xp !Yt !Ptpp+d'Pp!+d'Pt!'X| !pp !qt!Ptpp+d'Pp!+d'Pt!'X| Z!pp !qt$@$-$_$$$r$΁$軁UVS]u Ct$;d'/%ككSxككS|ككٓ؃ٓ؃ٓكٓك}E fEm]mM4b [x[|ٛٛ[tC ك$ tATxsu؋Iu( urASD$$ur[^][x[|ٛٛٛٛS؜vI dQKT$ $tE $ ][^]a؃[^]É$ t&'UWVS\u]ن 4نx( Ft}Mε fMm}m΋Um]m΋Uȋ<`'$E $E$zE7M U|( sH؍W$B} BgSBgS؆؆[؆[\[^_]Ð Wt$Xb 5Ft}Eδ fE$8b 5}MنUE ']نg]نg]ن ]ن`]ن`]L$$ ;‹CЉK\[^_]Ít&WL $m$r$E$mUT$ML$UD$T$ M$b L$4qUWVSLMEUD$ E }]uL$T$$U܍ME]EC]EC].]n]nT$D$L$ <$]Qt&'UU ED$T$$Í&'USUE ( ( ( ( :$pg t  9|;$e *$D$qg Z ) ] E[]t&@ \$O 뾐&UED$ $Ðt&UWVS<( eE1( ( E$e U+( MԉD$U補$vg 藜EED&9ut 9ut^D$\$<$Ǡt}EE;];];t $yf S~4+5( ;5( ~$f SU܋K{E4MWUUUT$ C\$$g D$跛2M܍ED$$g L$薛EA$vg ~u$g t$kEe3uJ<[^_]$vg K( +( +( $g \$)$vg ]蘟U]]u$1$\$Ɖ$h]u]Ít&USE$t؃[]$f t؃[]ÐUVS $g 輘$h 谘) tF1t&K L$C\$ST$ t$$k D$r[$u˅t [^]$ l T [^]Í'UVSu4$m`u [ t4$D$裟u[^]Í&'UWVS }<$`E1C ޅÉ|$$;u߅S$V ) tq1vC$ޅtaÉ|$$ute{$~$$l D$臘s 4$ $$- [^_]à 1[^_]Ës$M4`iS$) UVS) tC1$Hh T$跖$[$uڅtt$$+l 蒖[^]$hh [^]Ð&U~T$$\u$$h D$,$ޛ$h D$$Il $h ÉUVS) utCt9t[$u[^]Ë$$i T$谕$ԍt&US) u %[$tC~9Cr$[$u[]ÉUS) ti c[rQSt[D$ JL$$i D$XK LLS $dLLC [[$u[]< $dl L$ S $Í'US$]$Ut$i 腔1[]Ã=$($ ) H$ã) $$`S `E$M $C U SEC [CCLLtK SL$ D$Z$(j \$œ[]Ív$j 褓1[]Ë$lj T$芓Ð&UWVS,eE1O1ƅ\t)D$D$ 4$$ݘ)T$4$D$$軘$|8蚘9|$蚘D$D$$誕$ٝpD$ D$ D$$蘘م؞$1D$ D$ D$$Y$L$ \$م\$$sEe3uY,[^_]$j $j $k $8k ܑ$k Б$k ‘UD$ $zl 薦D$ $l 肦D$ $l nD$ $l ZD$p $l FD$p $l 2D$ $l D$ $l  D$P $l $ :/$ ./ÍUWVS=HLEE=LLG\ty $ M9EMXL$$tBV\$$ۓt/=LLG\t5]Nj$T$賓u&Em [^_]-M1$t$肓t֋_$ $D$jtUJ$L$Tt]_\t$$n ҏ;$ \$UJ $Pp}=HL7$n t$蕏[^_]Í'UVSHLut*LLt&t$$躒t[\ۉLLu1[^]Ã[^] UŔt$l É$贔$w$蛔$Su$/m ÎLLËLLJL$$l D$蘎$ m 茎LLJL$BD$ JL$B $m D$^LLJ(L$B$D$ J L$B$m D$0LLJ8L$B4D$ J0L$B,$m D$LLJHL$BDD$ J@L$B<$m D$ԍLLJXL$BTD$ JPL$BL$m D$覍Ít&US4Dt$@n C4[]$1$aw$$LL1ۋH t5Pt,H,t#P<t@Lt$dn ̎뇻$蹒ML$$ iڋMLLK E LLA] LLYELLBLLMEUL$D$ \$]T$$n \$3LL$%m MEU]L$D$ T$\$$n UHLtnLL$Nm $脲$gm D$褍LLt+BD$ $om L$聍LLP\҉LLuLL$@m WÐt&US$4t$n s$[]$!$Qw$$$]\$$=gLL$ D$fLL$T$tfLL$,T$Wf-LL$t^HLt)LL}Ct$$UtF[\ۉLLu$ 8tD$4$.ct1҃[^_]$e딉<$qLL<$ T$bug LL<$L$auNLL<$,\$au55LL<$]u CV+}J tktTt>t(tM fA +ALU t+4L1] D+LU t+4L1] D+LU t+4L1] D+9}L~ou D+T +TL t+tT L+LDt$+t LD,+D(\ыT4+T0tD<+D89}T2 ȉ$` EUUu]M}] Et [x4$)M\$L$օE0s] E}]tytAuoF$[ÃPt?Et:J&t.Kt)Bփvv9Jvut1[^_]ÉM $Mp[^_]t€{ u΋]]Y1v'UWVSUEHd~ KC  UtTNV ΀>Au\11ɍF$fƒPt(Et#JtKt*v/t1[^_]ËUSu[^_]À{ uЅ}s1ōUWVS MEF$1ɉЃO4<;w$x C9Et1EE [^_]1ɃExًUy͉ENV ΀>AxE [^_]ÃMtEy[]tMUWVSӃU׋r@RGD)9E σM MIMU:}}}t}tU}t-}t&M:QUJ:/UJ: UJ:UJ:UJ:UFJS:FS:usFS:ubFS:uQFS:u@FS:u/FS:uR[^_]Ã1[^_]Íʃ~:u׃tztatHt3tt&:u:u:u:l:X=Q: <N:K/F:C"N:KF:CN:KF:CJV:S:D:t&UWVSup]lNP9ȉsIEuW] Mq4Ѕtp;YDsJvP, 1"OWEu щ)ʋXMZJKtNXd~ZJ ˅~,U4;rZT[BMq\t ;^W91t&up;^D p@< $z p*MpyN@pDž\2t&tvtNt&pPpDž\p*\pp\pp\pp\pp\pp{\;\ppLpA8A*AAAAA\;\pit&MpyN@pDžX4t&txtNt&p5pDžXpXppXppXppXppXpp`X;Xpp1pAAAAAAAX;XpiMpyN@pDžT2t&tvtNt&p pDžTpTppTppTppTppnTppKT;TpppAAAAAAAT;Tpit&MpyN@jpDžP4t&txtNt&ppDžPpPppPppPppvPppSPpp0P;PpfppAAAAAAAP;PpiMpyN@SpDžL2t&tvtNt&ppDžLpLppLppLppaLpp>LppL;LpQppAAAAAAAL;Lpit&MpyN@:pDžHr4t&txtNt&ppDžHpHppHppiHppFHpp#HppH;Hp6ppAAAAAAwAiH;HpiX9Ɖprp9 u19]K\nGW Ѓ^3\ b DžЉ3ƃ\ b DžЉEX$1v{pd_w zAJyA 9At{] Zd~ _W ӋU ;JB tMQ )ڍ4ATMp+A@MWED$ L$l$pt$7EHTGW ǀ?AtUz 8UzL8UB z)؋EEUHB << )؋ UBU8p+B@8D 9lWlIS E]D$L$lD$ $UlT$t$D$ $VE WM]D$ D$p $l\$U} lp$D$ \$|$p>y\F AHMV^yT$\$<$?~u p$` E;}x9vp 9xu%_9t/9xt)9u;v19EuD$ D$L$l4$GtEMD$ D$ $lt$z;nM;AD\Q 9xF넋҉9 ~[9vS9tJ9t*9u )9uȋ9@E]lD$t$D$ $9sgUuL$lT$4$D$ %9 U;JD9냋MAp9~eUJD9ىDvU|ȃt() 9tD9u;MuD$ L$lD$4$9sMA t&MAMuD$ L$lD$4$;xE;PDf |ȃGx҉;}w9vo9uf9t*9t)9uȋ9v 19UulT$4$D$ \$tbUuL$lT$4$D$  9U;JD9냋tMUpL$l$t$D$ %9tU$pL$fZptu9 ~i9va9t,P&9t/9u )9u;FEuD$ D$L$l4$9ss<$z EMD$ D$ $lt$;  M;ADQ 9넋EP0tp;xHCpMqLlAPMAMAwMAb xG9}l9pscEHp@uHp)9pt9ptp@tʋp9ZMupL$lT$4$D$ )p9ps9}9psEHp@tp)9pT9pHp@u.989p,EHp@ p)9p9pp@t99pEHp@p)9ph9p\p@uB9L9p?EHp@ p)9p9pp@t99pEHp@p)9p{9pop@uUuX9V9pJp9 ;)كp9p9pp; u+p)9~pU(uuE eU1ҋM ]]oZ}}tЋUe3]u}]Å|taE$xDž<ES Dž,t7t A,t A<tA Et Is 0;ERCP00PQAIxڋ]M]t0$|BdZX ` hll\@DžpELP 0VUUUm$E$Y0)ƒARftȸVUUU)9IDž@ VUUUDDžT)ʉH0EJD 9E$}@Ã)Ӊڃ9)H9tgtUtGt9t&t&tt @H9w>AAAAAAA 9v‹@  /0B @GBDž  0F DžDžDžU4^(99Q9tftTtFvt5t'tt AQ9v>BBB BBBB 9w‹;$L>;9$<9UtitLt1t: 9 9<9: 9 9<9J9<9AQ<9tvAQ<9tcAQ<9tPAQ<9t=AQ<9t*AQ<9tyQ 9W֋M$)9l+<9(~9$cO99$W)ЃtHZу;;t"Bу;tu;tm$9B;RtK;tCB;Zt2;t*C;Zt;tC;uA;$sr(t8uDž8D$ D$|$$踻? u9$r @lhE$SDžDžDž #*;$9$މ29totXt@t)t:9[9I 9729%:99J9ى99qQ9yQ9AQ9qQ9yQ9AQ9sqQ9_[0F`@$d Ux9;$~ $ȃt|z tjtXtDt2t t z z }z pz cz Vz IB9ȉOr]ȋt+xDž,&E̅ EHt1ɋx$sx|$t$$`\xtMBPxxAFxm]ȅ0\MotoΈ1AP1Ʌt )ЉtBЈJx|$$L$ t00Dto1ɋt1FPtt )ЉtKCx؃|$$T$~t00\titot0#t11FPtt )ЉtJӈBx$|$D$0tTttoΈ1AP1Ʌt )ЉtBЈJx|$$L$stۍDtlo@P11t )ЉtBЈJx|$$T$tDto@P11t )ЉtBЈJx|$$L$t0Dt)Eȅt F0U̅ \1ۋt9UVM̈N}Ã#]ȉ]^EȈFxx ZEt1Ƀ}XBq,1 <ux~}E\xA EBM̉ЃJUȅx ;Ủ xƒXx Pƒ}̍^)}ȈEB]ȍBZU+Džƅg1ۃà oWډDIp$p`tpG$ `L$\$$<GBd=QXXI XXDžxG1]1ɋt{S t;Bu݃uEE> UDžP҉]x5Ex)Muĉt9)]E] ։uEyˋEƃ\ ߋut GeCE[DžLx&9t-Džx E) E} 9у QUA!<1E]EuM)w:nAiE  Ua Xvt-uv벋uF<:t <.t<=*Uǘ]O4{:Dž<uy^]u)1ȃ 9u t$D$<$ruƅEt 1v~[Dž8 q (ы<84 D*AD*AD*AD*AD*AD*AD*AD*փ!utM<88.]DžD މ]"؃5tP>OWtExE]t ~]FEF<\> 9 su@+@@ڋ@@TЅG@D9@t6@@TЅD@@ڋ@@TЅD@TЅt#A ډȃTЋ@ڃȉTЅt#A ډȃTЋ@ڃȉTЅt#A ډȃTЋ@D@ڋ@@TЅt#@A ډȃTЋ@D9ljDutnFOV N]DžXntxFMȋtNEȉكF xN ~IPt E tx|$4$L$ 9]̉tԋ]1[+ỦӉULJK| Ue&X}N\t5 xG$} EuD$4$ k ۍCOD $} t&EDžP}sOEx\DžT?o1@P1t )ЉtKوCx|$ $T$oD00tbxuEDžPDžDžPx$|$T$xxxx))C{B x)ƃWO!ƉxSKu`u] ]!)Q U1ɺPDžXP!FxوE8Eu X1X]GxqQ 9Bu싅t)ȉ,xىƒXx ˆXFBt؃Džtqȃ !ډx}t}uq 01]e3 \[^_]Àsxm \t+,C txxVى@A ډȃT@A ډȃT@A ډȃTuxEP_UruM B1ۃ<\zЉM u狍trt3PPd~ VF 9u͋ u3 ^ VuXJMruB<u\t7xƉEDžTi]DžDžxWu?tsV^ s]C9rt1計Tuދ }ʃUDž<q EMED$ $軂ud&txt1ɺ$x+xx|$t$1$\xtMx @B :u~\DžTut?+WQ*_Ytxtn4 D*AD*AD*AD*AD*AD*AD*AD*փ!urei4 : D*A D*A D*A D*A D*A D*A D*A D*փ!u UypEE>u+ $ZDž(0vsp (p;(p$$ `9҉(u$pw ]rHuDžXHvMJzMR_Ѐ)tuʍ\AЍNMV)u tquGLO_]KDžXKWtBLBBEE@uDr ]} ~:tD t+ F~VN )ƅ ԋtB+|Wt*|G9t ;)~EFƉE$pt+(pO T$щ $\$pp`teD r pF À}>tBָ>ZQ( ;_$G(1ttx uttxX$@ th 1 MGO,t;uЉڃs}ԉzM؉JE܉B ur]Z}zMJLt@ɉxt1҃ƒ @Htuxu]tXtxp Mz1lq ]Y \*σ!u D*σ!u\ ?\*σ!udD ?D*σ!uI\ \*σ!uMuD D*σ!ueu UWVSEU]uheE1҉d`\DžDžl;`E  E  \ \hDžDžف։@DžpDžtDžxDž|DžDžDžt&V^˅t4E @tt \DžE tu#tBtE @t *t+t?vt{C3Dž<\tP<[~-FFVux]<\uU D$$drdËpwې.U8\G~E@:ƉDž:ً+=(p1Džd{jdE /  Ft t89ȁN fFFV<\tp<]tlFx^9Dž 1 B9ʍ<)ыʍ|Dž\ O^NC<1w $T DžDžA)VZրv?t {_Dž PH u)# 1ۨttM )Džspt p\pPtu E 1!] DžDžDžtb L    ܃ @vԍ̉Ȁ=DžDž U D$$djd 3tjX&r DžlDžDžXƋdT ,=!~{CDžds DžlM ؋1ɉ$vqt N$t<9tˁN@f^iBz?uJ=!<dƉr $~)N{1ۉΉDžUd, dr DžDžNNXXt ^ ڋX[u>uRx+9|}01ۉ|Džtd Jdr dr dqr Fiud  d$j3? P@<+= 0unimplemented bulitinBad stringstrunzone: bad stringPF_setmodel: no precache: %s '%5.1f %5.1f %5.1f'%5.1fwbstrzone: out of string memorybreak statement Shouldn't be at MSG_ONEWriteDest: bad destinationPF_fgets: File out of range PF_fgets: File is not open PF_fclose: File out of range PF_fclose: File is not open data/%sskinbnameEntity is not a clientWriteDest: not a clientPF_Find: bad search string*version2.40*qwe_version*userid*gamedir%s/maps.bsp$Intermission think. No maps. %d-%d%s%s %c %d:%s %s%s%c %s %03d%s%-13s%s %s%-13s %s%c%s%sTotal:%s %d maps %.0fKB (%.2fMB) #bad date#\%s\%s\ map %s exec qwmcycle/mapParm 0 not a clientdisconnect stufftext buffer overflowpr_checkextension%s/%s.logcoldn't open log file %s timeofdayweapons/jetjump.wavbotcountdown_timer======OBJECT ERROR in %s: %s ======SERVER ERROR in %s: %s pr_tempstringcountpr_tempstringsize4096DP_CON_SETDP_QC_CVAR_STRINGDP_QC_MINMAXBOUNDDP_QC_RANDOMVECDP_QC_SINCOSSQRTPOWDP_QC_TRACEBOXFTE_CALLTIMEOFDAYQSG_CVARSTRINGZQ_CLIENTCOMMANDZQ_ITEMS2ZQ_MOVETYPE_NOCLIPZQ_MOVETYPE_FLYZQ_MOVETYPE_NONEZQ_PAUSEZQ_QC_STRINGSZQ_QC_TOKENIZE A:3,%Ժ?@@@TU0V`WZ`[^0_`a0b@cg@no0pq r s` t vwP$p@Pp @pPR_InitBuiltinsstrunzone: not a dynamic stringPF_Precache_*: Precache can only be done in spawn functionsWARNING: Model count over 255 but precaching anyways: %s No room to precache model: %s No room to precache SOUND: %s PF_Write_*: MSG_INIT can only be written in spawn functionsVarString (builtin call ending with strings) exceeded maximum string length of %i charsPF_fgets: File is from wrong instance PF_fclose: File is from wrong instance max: must supply at least 2 floats min: must supply at least 2 floats tried to listmap to a non-client \frag\%s\%s\%s\%s\%d-%d-%d %d:%d:%d\ PF_cvar_set: variable %s not found tried to sprint to a non-client class %s and netname %s that %s 9RFߑ?࿚?cܥL@NUM_FOR_EDICT: bad pointerEDICT_NUM: bad number %iedictedictsedictcountvoid%f %f %fbad type %ientity %i%s().%snum_edicts:%3i active :%3i view :%3i touch :%3i step :%3i FREE %i entities EDICT %i: %s.datqwprogs.datPrograms occupy %iK. DAT*qvm*progsSpectatorConnectSpectatorThinkSpectatorDisconnectChatMessageUserInfo_ChangedConsoleCmdUserCmdlocalinfoChangedGE_ClientCommandGE_PausedTicGE_ShouldPauseMTF_SpawnBotsMTF_RemoveBotsautohttp://ktpro.does.it/ forhttp://qwex.n3.net/ forTreat mod as ktpro. EDICT %i: Can't find field %s Can't find function %s angleangleslightlight_lev%s is not a field 0 %s 0ED_ParseEdict: parse error%s is not a global ED_ParseGlobals: parse error{ "%s" } %i(???)%i(%s)%i(%s)%sNo classname for: No spawn function for: %i entities inhibited sv_progsnameqwprogsW*S+,+***u*+,,,V,,++<<=n=L=#=<@@PR_LoadProgs: couldn't load progs.datprogs.dat has wrong version number (%i should be %i)You must have the progs.dat from QuakeWorld installedPR_LoadProgs: pr_fielddefs[i].type & DEF_SAVEGLOBALED_ParseEntity: EOF without closing braceED_ParseEntity: closing brace without dataWARNING: Edicts over 512, expect crazyness WARNING: ED_Alloc: no free edicts ED_LoadFromFile: found %s when expecting {MAX_PRSTR%7i %s %12s : %s %sbranch %iprog stack underflowstack overflowassignment to world entityNULL functionBad builtin call numberBad opcode %iDONEMUL_FMUL_VMUL_FVMUL_VFDIVADD_FADD_VSUB_FSUB_VEQ_FEQ_VEQ_SEQ_EEQ_FNCNE_FNE_VNE_SNE_ENE_FNCLEGELTGTINDIRECTADDRESSSTORE_FSTORE_VSTORE_SSTORE_ENTSTORE_FLDSTORE_FNCSTOREP_FSTOREP_VSTOREP_SSTOREP_ENTSTOREP_FLDSTOREP_FNCRETURNNOT_FNOT_VNOT_SNOT_ENTNOT_FNCIFNOTCALL0CALL1CALL2CALL3CALL4CALL5CALL6CALL7CALL8STATEGOTOBITANDBITORPR_ExecuteProgram: locals stack underflow PR_ExecuteProgram: locals stack overflow PR_ExecuteProgram: NULL functionKb__;_Y_w_______1``b`u`````a!a.a;anaHananananaaaaaaaaaaaaaaKbb$bb dc#db@d@d@d@d@d@d@d@d@dccbccDcisBot%s/%s/*%s%s/%s/%sPR2_InitProg gamedata == NULLPF2_FS_OpenFile %s date_str*VIP*statenospawnedunknownzombiepreconnectedyesmaps/%s.bspCan't find %s PF2_Find: bad search stringPF2_stuffcmd: NULL pointerPF_precache_sound: overflowrbabPF2_QVMstrftime: wrong buffer PF2_QVMstrftime: buffer size too small tried to set cmd a non-botclient %d tried to disable_updates to a non-client tried to change userinfo a non-botclient %d tried to remove a non-botclient %d \name\%s\topcolor\%d\bottomcolor\%d\emodel\6967\pmodel\13845\skin\%s\*bot\1PR2_fcloseall: pr2_num_open_files != 0 PR2_InitProg: Incorrect API version (%i should be between %i and %i)PR2_infokey: buffer size too small tried to centerprint to a non-client %d tried to sprint to a non-client %d sv_sys_callex: Bad API call numbersv_syscall: Bad API call number%i. ehhh Precaching model: %s @BPG#ȪWARNING: ED2_Alloc: no free edicts -progtypesv_progtypePR2_GetString error off %8x/%8x PC %8x LP %8x SP %8x %10.10s %8d %10.10s code length: %8xh instruction count: %8xh data length: %8xh stack length: %8xh PC-%8x %s + %d Error num in stack %8x/%8x %8x %s + %d %8x unknown VM_PrintInfo: NULL vm native bytecode interpreted instruction count: %8d QVM Program errorQVM runaway loop errorOP_UNDEF OP_BREAK MAX_PROC_CALL reached VM_Call with NULL vmVM_Call with VM_NONE type vmVM_Call with bad vm->typeLoading symbol information %s.map%d %8x %s%i symbols loaded from %s %s.qvmVM_LoadBytecode: load %s QVMqvmcodeqvmdataVM_Unload "%s" %s/%s.soLoadLibrary (%s) dllEntryvmMainVM_Load: bad parmsVM_Load: "%s" profiling no enabled %9d %s sv_enableprofileOP_UNDEFOP_IGNOREOP_BREAKOP_ENTEROP_LEAVEOP_CALLOP_PUSHOP_POPOP_CONSTOP_LOCALOP_JUMPOP_EQOP_NEOP_LTIOP_LEIOP_GTIOP_GEIOP_LTUOP_LEUOP_GTUOP_GEUOP_EQFOP_NEFOP_LTFOP_LEFOP_GTFOP_GEFOP_LOAD1OP_LOAD2OP_LOAD4OP_STORE1OP_STORE2OP_STORE4OP_ARGOP_BLOCK_COPYOP_SEX8OP_SEX16OP_NEGIOP_ADDOP_SUBOP_DIVIOP_DIVUOP_MODIOP_MODUOP_MULIOP_MULUOP_BANDOP_BOROP_BXOROP_BCOMOP_LSHOP_RSHIOP_RSHUOP_NEGFOP_ADDFOP_SUBFOP_DIVFOP_MULFOP_CVIFOP_CVFIError ret adress %8x in stack %8x/%8x QVM_Exec MAX_vmMain_Call reachedinvalid opcode %2.2x at off=%8x bad cs off in map file %s.map bad ds off in map file %s.map VM_LoadBytecode: stacksize greater than data segmentVM_Unload: couldn't unload module %s VM_LoadNative: couldn't initialize module %s+ydJ2}aE) oO/{D!iAwhL0xb@-cheats*cheatsnslookupcheck_mapssnapsnapallkickstatusrmdirrmloadipcuffpenaltylistpenaltyremovechmod-enablelocalcommanddevmapsetmasterheartbeatquitrestartgodgivenocliplocalinfoserverinfosv_gamedirfloodprotfloodprotmsgmaster_rcon_passwordmaplistuptimeActive Penalty List: %i %s mute (remaining: %d) %i %s cuff (remaining: %d) Saved Penalty List: MuteCuffUnknownNo floodprots enabled. Current msg: %s userid not found %s/snap/%d-00.pcx%s/snap/%scmd snap Usage: snap Current gamedir: %s Usage: gamedir Current *gamedir: %s Usage: user Local info settings: [%d/%d] Localinfo %s: "%s" No such key %s Server info settings: Serverinfo %s: "%s" kmodxmodxbuildid1/mapsqw/maps%5i %3i %-15s %-15s %3d%% %4i %4i %5.1f %s %s %-16s %4i %5i %6i %-22s %-15s%3d%% CONNECTING ZOMBIE address real ip (s)%-18s %4i %5i %6s %s %-36s BOT%-16s %4i %5i %6i %-22s Usage: nslookup Name: %s Address: %s Couldn't resolve %s penaltyremove [num] Removed. Couldn't find user %s %s un-muted. %s un-cuffed. ls /..//..Unable to list %s Content of %s/*.* .*No files - %s %s %.0fKB (%.2fMB) %s %dB noclip ON noclip OFF godmode OFF godmode ON kick [reason] (%s was kicked%s kick%s Couldn't find user number %i & banned%s was kicked%s%s You were kicked%s%s kickbanusage: %s [reason] localcommand [command] __output_temp_file__> %s 2>&1 command failed (empty) Unable to remove file %s Unable to remove Removing %s... %d files removed No matching found File %s succesfully removed chmod Unable to chmod Unable to chmod %s Chmod %s succesful rmdir changing no maps. Contents of %s/maps/*.bsp: %-16.*s %-1.*s %d day%s/%s%i.logCan't open any logfiles. Logging %s to %s %s/%s%d_%04d.logFailed. telnet_log_levelqconsole_log_sayserver shutdown Shutting down. if_cfgdirsv_cheatsqconsole_File logging off. logerrorsqerror_Error logging off. logrconrcon_Rcon logging off. logtelnetqtelnet_Telnet logging off. Frag file logging off. logplayersplayer_Player logging off. modfraglogfilemodfrag_Mod frag file logging off. modfragsmaster_rcon_password can be set only in server.cfg %i: %s for %i.%i.%i.%i (remaining: %d) Current floodprot settings: After %d msgs per %d seconds, silence for %d seconds Usage: floodprot <# of messages> Use floodprotmsg to set a custom message to say to the flooder. All values must be positive numbers Can only track up to 10 messages. Userid %i is not on the server You must run the server with -cheats to enable this command. Usage: floodprotmsg "" Snap: Couldn't create a file, clean some out. Requesting snap from user %d... Gamedir should be a single filename, not a path Usage: sv_gamedir *Gamedir should be a single filename, not a path usage: localinfo [ ] Star variables cannot be changed. usage: serverinfo [ [ ] ] WARNING: Storing maps list in LOCALINFO supported only by ktpro version 1.63 build %i and newer and by ktx. Current running ktpro version %s build %s. Current running mod is not ktpro and is not ktx. net address : %s cpu utilization (overall) : %3i%% cpu utilization (recording) : %3i%% avg response time : %i ms packets/frame : %5.2f (%d) map : %s frags id address name rate ping drop real ip ----- --- --------------- --------------- ---- ---- ----- --------------- name ping frags id address real ip ---------------- ---- ----- ------ ---------------------- --------------- name ping frags id ------------------ ---- ----- ------ Didn't find penalty filter %i. usage: mute [reason] (default = 0.5, 0 = cancel mute). %s muted for %.1f minutes%s%s You are muted for %.1f minutes%s%s usage: cuff [reason] (default = 0.5, 0 = cancel cuff). %s cuffed for %.1f minutes%s%s You are cuffed for %.1f minutes%s%s Total: %d files, %.0fKB (%.2fMB) You were kicked from the game%s rm { | * | *} - removes a file | with token | all Directory %s succesfully removed Unable to remove directory %s \newmap\%s\\\\%d-%d-%d %d:%d:%d\ map : continue game on a new level Contents of %s/maps/*%s*.bsp: Wildcard total: %d maps, %.1fMB Directory total: %d maps, %.1fMB uptime: %s%02d hr%s%02d min%s Zrconsole: Gz?B #< ADpBA-democacheeasyrecordstopcanceldlistrdlistregexdemolistdemolistrdemolistregexrmdemormdemonumscriptdemoInfoAdddemoInfoRemovedemoInfoNot recording demo! invalid demo num failed to remove the file file removed **a+ba+tfailed to open the file failed to open input file failed write to file Clearing %d old demos Smile, you're on QTV! duel: %s vs %s @ %s - %i:%i players: ffa: %s (%i) %s(%i) @ %s tp:team[%i] %s: %s[ %s(%i) ](%i) ERROR: couldn't open "%s" diskw+tNo demos. List of %d last demos: %i. content of %s/%s/%s no demos *%d: %s %dk directory size: %.1fMB space available: %.1fMB bad demo message type:%dNot recording a demo. QTV disconnected EndOfDemoServer recording completed rmdemonum <#> demo %s succesfully removed script %s "%s" "%s"unable to remove demo %s removing %s... %d demos removed no matching found demo %s successfully removed fullserverinfo "%s" cmd spawn %i 0 skins easyrecord [demoname] %don%d_[%s]_%s_vs_[%s]_%s_%sduel_%s_vs_%s_%sffa_%s(%d)%s%s%s^%s%s%s_%02i%s/%s/%s.mvdrecord Not active yet. script %s "%s" "%s" "%s" %sQTVqtv, got (%s) (%s) VERSIONRAWPASSWORDAUTHPLAINCCITMD4%X%X%X%XQTVSV 1 AUTH: MD4 CHALLENGE: QTVSV 1 AUTH: MD5 CHALLENGE: QTVSV 1 BEGIN sv_demoUseCachesv_demoCacheSizesv_demoMaxDirSize102400sv_demoClearOldsv_demoDirsv_demofps30sv_demopingssv_demonovissv_demoMaxSize20480sv_demoExtraNamesqtv_streamportqtv_maxstreamsqtv_passwordsv_demoPrefixsv_demoSuffixsv_demotxtsv_onRecordFinishsv_onDemoRemovesv_demoRegexp\.mvd(\.(gz|bz2|rar|zip))?$MVD_Init: you must specify a size in KB after -democacheMinimum memory size for demo cache is %dk SV_MVDName2Txt: pcre_compile(%s) error: %s at offset %d SV_MVDName2Txt: pcre_exec(%s, %s) error code: %d usage:demoInfoRemove = * for currently recorded demo usage:demoInfoAdd = * for currently recorded demo failed to read or empty input file Insufficient directory space, increase sv_demoMaxDirSize date %s map %s teamplay %d deathmatch %d timelimit %d player1: %s (%i) player2: %s (%i) Server starts recording (%s): %s MVD_PlayerReset: wrong player num %d usage: lastscores [] = '0' for all demos = '' for last %i demos was decreased to %i: match is in progress. was decreased to %i: command from connectionless packet. usage: demoinfo = * for currently recorded demo Sys_listdir: pcre_compile(%s) error: %s at offset %d Sys_listdir: pcre_exec(%s, %s) error code: %d MVD_StreamStartListening: socket: (%i): %s MVD_StreamStartListening: ioctl FIONBIO: (%i): %s QTVSV 1 ERROR: This server enforces a limit on the number of proxies connected at any one time. Please try again later MVD streaming client connected from %s DemoWriteDest encoundered bad dest.Server recording canceled, demo removed Server recording stoped Max demo size exceeded rmdemo - removes the demo rmdemo * - removes demo with in the name rmdemo * - removes all demos DestFlush encoundered bad dest.qtv: received unrecognised auth method (%s) QTVSV 1 PERROR: You need to provide a common auth method. QTVSV 1 PERROR: FTEQWSV bug detected. QTVSV 1 AUTH: CCITT CHALLENGE: QTVSV 1 PERROR: You need to provide a password. QTVSV 1 PERROR: Bad password. QTVSV 1 PERROR: Incompatable version (valid version is v1) DMbP?PZEntity number >= 2048Unset entity numberU_REMOVEsource/sv_ents.cfalseLOL, %d, %d, %d, %d %d %d demo sv_nailhackEll?ll??SV_WritePlayersToClientsv.num_signon_buffers == MAX_SIGNON_BUFFERS-1SV_ModelIndex: model %s not precachedSV_CheckModel: could not load %s Cant load map %s, falling back to %s progs/player.mdlprogs/eyes.mdlSpawnServer: %s items2CM_LoadMap: bad mapMVDSVmaps/%s.entUsing entfile maps/%s.ent *entfileServer spawned. login time out for %s waited too long, Bye! account %s blocked account %s not blocked account %s unblocked account %s not found account list is empty account list: blocked%.16s %s %d login(s) found %s/accountswt%s %s %d %d %s %s %d Password for %s: Login blocked Login in use! try again: %s logged in as %s Welcome %s setinfo name %s usage: acc_block usage: acc_unblock usage: acc_remove login %s removed account for %s not found %d.%d.%d.%dacc_createacc_removeacc_listacc_unblockacc_blockMAX_ACCOUNTS reached Invalid login! Invalid pass! Login already in use login %s created couldn't open accounts sv_loginWarning: couldn't open for writing accounts account %s blocked after %d failed login attempts Access denied Password for %s: Enter your login and password: usage: acc_create [] acc_create
maximum %d characters for login/pass usage: acc_create
maximum %d characters for username aEG@Dout of handlesError opening %s: %sVIP list: %3i.%3i.%3i.%3i level %d %s/%s/listip.cfgIPFilter: writing to %s... addip %i.%i.%i.%i %s addip %i.%i.%i.%i mute %i.%i.%i.%i %s mute %i.%i.%i.%i %3i|%3i.%3i.%3i.%3i| ban|safe|unkn|%4ldd:%2ldh|%4ldh:%2ldm|%4ldm:%2lds|permanentBan list: empty Filter list: %3i.%3i.%3i.%3i | | %i s%a %b %d, %H:%M %Y%d/%m/%Y%H:%M:%SIPList : no active filters. %m/%d/%y %H:%I%p<%s>n/a%3i.%3i.%3i.%3i %-16s %s %d-%m-%Y%a %b %d, %H:%M:%S %Y[%s].[%d] %s%s\%s\%i\%s\%s\%i%s *adminWriting %s. Couldn't open %s addip %i.%i.%i.%i safe %.0f addip %i.%i.%i.%i %s %.0f %s/vip_ip.cfgvip_addip %i.%i.%i.%i %d <setinfo "%s" "%i" stuffstuffallreloadaddtimerremovetimerremovealltimerstimerlistvip_addipvip_removeipvip_listipvip_writeip*%iMVDSV 0.27bXE*z_extdelayed_packetsBad filter address: %s Didn't find %s. usage: removeip
none banned. ..\Invalid path. Running %s.qws %d %smod_adminYou are not an admin usage: cmd banrem [banid] Wrong ban id: %d %3i.%3i.%3i.%3i was unbanned writeip ban: bad ip address: %s ban: can't ban such ip: %s %d%sban: wrong time arg %s was banned for %d%s%s addip %s ban %s%.0lf offRcon Watch stopped Rcon Watch started for %s disconnectStealth spectator %s removed Spectator %s removed Client %s removed (%d)%-.40sname spam%s changed name to %s name changelwlogchat bad rcon from %s: %s Bad rcon_password. No access. no access. Unknown command. main rcon from %s: %s A2A_ACK from %s topcolorbottomcolor\s\%s-9999%i %s %i %i "%s" "%s" %i %i%i %i %i %i "%s" "%s" %i %i sending log %i to %s stdlog %i %c Server is version 2.40. %c Bad challenge. %c No challenge for address. %s:no stealth spectators %c no stealths *spectator%s:spectator password failed %s:password failed %s:dup connect %s:reconnect %s:full connect svf%c server is full %cgetchallenge%c%i%s timed out Updated needpass. needpassServer shutdown. SV_Error: %s server crashed: %s -minmemory-portPort: %i -telnetportTelnet port: %i -HOST_HUNKLEVEL-exec rcon.cfg exec server.cfg loadip %4.1f megabyte heap MVDSV 0.27bXE started map startCouldn't spawn a serverStandbyusage: stuffall Freed frag log file %s/%s/frag%i_%i.log%s/%s/%s_%i.log%H:%M:%S %m/%d/%y%s_%iLogFile : logging %s to %s sv_cpserversv_mintic0.013sv_maxticsys_select_timeout1000000sys_restart_on_errordeveloper65zombietimestealth_passwordsv_hashpasswordstelnet_passwordnot_auth_timeout3600sv_crypt_rconsv_timestamplen60sv_rconlim10frag_log_typesys_command_linesv_use_dnsspectator_passwordvip_passwordvip_valuesallow_downloadallow_download_skinsallow_download_modelsallow_download_soundsallow_download_mapsallow_download_pakmapsallow_download_demosallow_download_otherdownload_map_urlsv_specprintsv_reconnectlimitsv_admininfosv_unfakesv_kicktopsv_allowlastscoressv_maxlogsizesv_logdirsv_speedchecksv_phspausablesv_maxratesv_getrealipsv_serveripsv_forcespec_onfullsv_maxdownloadratesv_MegaTFHackssv_loadentfilessv_default_nameunnamedsv_mod_msg_filefraglimittimelimitteamplaysamelevelmaxclientsmaxspectatorsmaxvip_spectatorsdeathmatchwatervisserverdemomaxfpsskillcoopsv_pausedhostnamesv_forcenicksv_registrationinfosv_maxuseridlock_cvarLevelslock_cmdLevelsregisteredsv_ktpro_modesv_readableOutputsv_nostealthsv_timestamplogconsolelogclientlogfragslogchatcon_cleanoutcon_cleanincon_colorcon_promptcon_talkcon_cleanlogsv_timeformat[%I:%M]if_autosaveERROR: sv_timeformat.string must be 16 bytes or less IPFilter: bad filter address: %s. IPFilter: bad filter address: %i.%i.%i.%i. IPFilter: error: couldn't open %s IPFilter: warning: unknown filter with type "%d" IPFilter: wrote %d bans and %d mutes (%d total; %db extended info). IPFilter: user does not exist. IPFilter: couldn't translate address "%s". IPFilter: error: address masked or already defined in filter list. IPFilter: error: too many filters. IPFilter: removed %d previous addresses masked by new filter. %s %3.3s|%15.15s|%4.4s|%9.9s address expires ext. info --------------- ---------------- --------- Can't write in %s log file: %sN.log. Can't write in %s log file: %s%i.log. WARNING: sys_select_timeout can't be less then 10 (10 microseconds) and more then 1 000 000 (1 second). WARNING: You can't set setinfo %s %s %i. MVDSV 0.27bXE (l), build %d Build date: Oct 12 2004, 07:54:52 VIP spectator IP list is full IPFilter: %s: bad address to remove. IPFilter: freeing address %i.%i.%i.%i. IPFilter: couldn't find address %s. usage: addip
[reason] IPFilter: added ban %i.%i.%i.%i to filter list usage: script [] Can't remove such ban with id: %d usage: cmd banip > %3i.%3i.%3i.%3i was banned for %d%s addip %i.%i.%i.%i ban %s%.0lf usage: cmd ban > [reason] Rcon Watch is already being made by %s You are not connected to server! WARNING: Limiting rcon response from %d to %d rcon pequests per second from %s %s was kicked for name spamming You were kicked from the game for name spamming client %s (%s*) tried to bypass ban level %i restricted command from %s (%s): %s level %i restricted variable from %s (%s): %s level %i invalid command from %s (%s): %s level %i rcon from %s (%s): %s * rejected connect from version %i %c Invalid userinfo. Restart your qwcl Client supports 0x%x fte extensions %s:stealth spectator password failed %c requires a stealth spectator password %c requires a spectator password %c server requires a password %s:reconnect rejected: too soon %c server is full: connecting as spectator bad connectionless packet from %s: %s Forcing pm_airstep to 0 in ktpro Pause released since no players are left. beginning fraglog sequence %i SV_ReadPackets: fixing up a translated port SV_Error: recursively entered (%s)Only %4.1f megs of memory reported, can't execute game======== QuakeWorld Initialized ======== ============================================ usage: stuff LogFile : warning: unable to open frag.log LogFile : logging frags to %s. LogFile : freed %s log file %s.log *** Console Logging Session Started: %s *** Client Logging Session Started: %s *** Chat Logging Session Started: %s *** Rcon Logging Session Started: %s LogFile : warning: unable to open file %s Ban list:idip masktypeexpire?%c Sending heartbeat to %s %c %i %i Setting nomaster mode. Master server at %s Sending a ping. CWARNING: qwmsg_pcre_check: pcre_compile(%s) error %s WARNING: sv_mod_msg_file_OnChange: can't open file %s. Initialized default mod messages. Total: %d messages. Initialized mod messages from file %s. Total: %d messages. (.*) can't exist on slime alone(.*) was telefragged by his teammate(.*) was telefragged by her teammate(.*) tries to put the pin back in(.*) discharges into the slime(.*) discharges into the water(.*) gets a frag for the other team(.*) was lead poisoned by (.*)(.*) chewed on (.*)'s boomstick(.*) ate 8 loads of (.*)'s buckshot(.*) ate 2 loads of (.*)'s buckshot(.*) was straw-cuttered by (.*)(.*) was gibbed by (.*)'s grenade(.*) was smeared by (.*)'s quad rocket(.*) was brutalized by (.*)'s quad rocket(.*) was gibbed by (.*)'s rocket(.*) gets a natural disaster from (.*)%s\%s\%s\%d dieaxessgsnggllgraildrowntrapteledschrgsquishstomps(.*) sleeps with the fishes(.*) sucks it down(.*) gulped a load of slime(.*) burst into flames(.*) turned into hot slag(.*) visits the Volcano God(.*) cratered(.*) fell to his death(.*) fell to her death(.*) blew up(.*) was spiked(.*) was zapped(.*) ate a lavaball(.*) died(.*) tried to leave(.*) was squished(.*) suicides(.*) becomes bored with life(.*) discovers blast radius(.*) electrocutes himself.(.*) electrocutes herself.(.*) discharges into the lava(.*) heats up the water(.*) squished a teammate(.*) mows down a teammate(.*) checks his glasses(.*) checks her glasses(.*) loses another friend(.*) was ax-murdered by (.*)(.*) was body pierced by (.*)(.*) was nailed by (.*)(.*) was perforated by (.*)(.*) was punctured by (.*)(.*) was ventilated by (.*)(.*) eats (.*)'s pineapple(.*) rips (.*) a new one(.*) rides (.*)'s rocket(.*) accepts (.*)'s shaft(.*) was railed by (.*)(.*) was telefragged by (.*)(.*) squishes (.*)(.*) accepts (.*)'s discharge(.*) drains (.*)'s batteriesBA BA4BCa < CWCaCWARNING: backbuf [%d] reliable overflow for %s WARNING: MAX_BACK_BUFFERS for %s ffffff?misc/h2ohit1.wavSV_FlyMove: !trace.entGot a NaN velocity on %s Got a NaN origin on %s demon/dland2.wavSV_Physics: bad movetype %isv_maxvelocity2000sv_gravity800sv_stopspeed100sv_maxspeed320sv_spectatormaxspeed500sv_acceleratesv_airacceleratesv_wateracceleratesv_frictionsv_waterfrictionpm_ktjumppm_bunnyspeedcappm_slidefixpm_airsteppm_pground@@@?<Akkkkl l lll l lAprogs/spike.mdlprogs/s_spike.mdlSV_Multicast: bad to:%iSV_StartSound: volume = %iSV_StartSound: channel = %i%s: backbuf %d bytes %s overflowed 3*ӇWARNING: msg overflowed in SV_SendDemoMessage WARNING: demo.datagram overflowed in SV_SendDemoMessage WARNING: datagram overflowed for %s WARNING: msg overflowed for %s SV_StartSound: attenuation = %fSV_StartSound: %s not precacheed WARNING: reliable overflow for %s Console busy by another user. Console busy by: %s. Refuse connection from: %s Time for authentication finished. Time for authentication finished. Refuse connection from: %s Connection closed with error: (%i): %s. WARNING: Can't setgid to group "%s": %s WARNING: user with uid %u unknown, but we will try to setuid WARNING: Can't initgroups(%s, %d): %sWARNING: Can't setuid to user "%s": %s Accept connection from: %s # cd %s ./%s.qws %s & cd .. Connection closed by user. Authenticated: yes Authenticated: no Restart failed: %s Fatal error: %s mkdir %s: (%i): %s -heapsize-mem-dsetsid: %s /dev/null-gWARNING: group "%s" unknown -uWARNING: user "%s" unknown -tchroot %s failed: %s chdir("/") to %s failed: %s sys_nostdoutsys_extrasleepư>B«Stealths command is stealth spectator exclusive You cannot enter observer mode as a stealth spectator. Your QW client doesn't support this command This server requires a %s password. Please disconnect, set the password and reconnect as %s. Can't join, all spectator slots full Can't join, all player slots full Vote for maps by typing the mapname, for example "%s" ---%s Can't change pm_airstep: ktpro detected Can't change pm_airstep: demo recording in progress or serverinfo key status not equal 'Standby'. Can't change sv_minping value: demo recording in progress or ktpro serverinfo key status not equal 'Standby'. Can't change sv_minping: sv_enable_cmd_minping == 0. Value must be >= 0 and <= 300. usage: minping [] = '' show current sv_minping value v_idlescale 0;v_cshift 0 0 0 0 Download stopped and download queue cleared. upload [local filename] [remote filename] a User is trying to call this: %s %s %s %s was kicked for userinfo spam You were kicked from the game for userinfo spamming usage: setinfo [ ] You can't change your name while you're muted You can't change your name while logged in on this server. %s was kicked for topcolor spam You were kicked from the game for topcolor spamming server: you cannot talk while muted. You can't talk for %d more seconds FloodProt: You can't talk for %d seconds. Can't suicide -- already dead! WARNING: Incorrect server ip address: %s Set hostname in your operation system or set correctly sv_serverip cvar. %c Failed to validate client's IP. Stealth spectator %s connected WARNING %s: [SV_New] Back buffered (%d0), clearing SV_Begin_f from different level %s WARNING: missing player/eyes model checksum %s WARNING: non standard player/eyes model detected alias "stealths" "cmd stealths" Spawn not valid -- already spawned SV_Spawn_f from different level SV_Spawn_f: Invalid client start prespawn not valid -- already spawned SV_PreSpawn_f from different level SV_Modellist_f: %s send an invalid index Map model file does not match (%s), %i != %i/%i. You may need a new version of the map, or the proper install files. WARNING %s: [SV_PreSpawn] Back buffered (%d0), clearing modellist not valid -- already spawned SV_Modellist_f from different level WARNING %s: [SV_Modellist] Back buffered (%d0), clearing SV_Modellist_f: Invalid modellist index soundlist not valid -- already spawned SV_Soundlist_f from different level SV_Soundlist_f: Invalid soundlist index WARNING %s: [SV_Soundlist] Back buffered (%d0), clearing AddLinksToPmove: check->v.modelindex >= MAX_MODELSSOLID_BSP with a non-bsp modelwarning: map cycle broke or not found; restarting map and resetting mapcycle sequence SV_ReadClientMessage: badread SV_ReadClientMessage: unknown command char Failed command checksum for %s(%d) (%d != %d) Invalid argument. Please use: pm message You can type "users" in the console for a userlist. No message typed. Please use: pm message Server receiving %s from %d... %s upload completed. To download, enter: download %s Userid not found. Please use: pm message say "ATTENTION: Attempt to use ktpro bug: id '%d', name '%s', address '%s', realip '%s'!" usage: cmd dl [\] # [# [#]] where "#" is demonum from demo list and "\" clear download queue you can also use cmd dl ., .. or any quantity of dots where . is the last recorded demo, .. is the second to last recorded demoand where N dots is the Nth to last recorded demo Download queue already exists. usage: download demonum/nun if num is negative then download the Nth to last recorded demo, also can type any quantity of dots and where N dots is the Nth to last recorded demo userid name %6i %s %i total stealth spectators info_player_startplayer%s---%s ztndm3list of custom mapsend of listValue must be 0 or 1. %s turns %s %s pm_airstep = %s usage: airstep [0 | 1] %s refused remote screenshot %s dropped sv_minping = %s Current rate is %i Net rate set to %i Invalid client to track Upload denied stopulClient not tagged to upload. Bad file name. File already exists. cmd fileul "%s" Logged in. Demo number %d not found. download demos/%s All demos downloaded. Incorrect demo number. 99999changing reconnect Download completed. userinfo spamUser info settings: topcolor spam[STLTH] %s: %s[SPEC] %s: %s(%s): %sFloodProt: %s packet %s "ip %d %d" cmd new VIP spectator %s connected Spectator %s connected Client %s connected dropped %dpmodelemodelServer is paused. cmd spawn %i %d cmd spawn %i cmd prespawn %i %i reload pmuidPM sent to %s: >>PM from %s: User %s called maplist setinfoBad user command %s Can't create %s Receiving %s from %d... UPLOAD: %d received nextul %s upload completed. judge-0not detectedDownload queue cleared. Download queue empty. Pause not allowed. Spectators can not pause. %s paused the game %s unpaused the game \chunkDownloading: %d => %d, total: %d => %d; %d download [filename] skins/progs/sound/maps/demos/demonum/pwd.cfgFindFile: %s Couldn't download %s to %s Downloading %s to %s Map %s is %.0fKB (%.2fMB) Download this map faster: %s%s File %s is %.0fKB (%.2fMB) sv_spectalksv_stealthtalksv_sayteam_to_specsv_mapchecksv_minpingsv_enable_cmd_minpingsv_use_internal_cmd_dlsv_kickuserinfospamtimesv_kickuserinfospamcount150sv_maxuploadsize1048576sv_downloadchunksperframesv_botscorenewmodellistsoundlistprespawnbeginpausesay_teamnextdlptracktechloginuploadstopdownloadstopdldemoinfobanipbanremjoinobservestealthlistpm_airstepV V V W :Y Z [ Z ?Not enough memory freeA@BB.wpt------------ %d commands %x %I:%M:%S %p%s/rcon.cfgWriting %s... 1.41mdvsvset_cmdLevel %s %i set_cvarLevel %s %i //Rcon Accounts: rcon_add %s %s %i rcon_addip %s %i.%i.%i.%i execechowaitcmdlistunaliasallunaliasifCbuf_InsertText: overflow ==!=<>>=<=!isinunknown operator: %s thenelseCbuf_AddText: overflow Unknown command "%s" Alias name is too long Unknown alias "%s" Current alias commands: %s : %s %s.cfgcouldn't exec %s execing %s // Generated by %s Server %s // on %s // Adjusted command and cvar levels: //wrote %i command levels, %i cvar levels and %i accounts Rcon_Write: %i cmd levels; %i cvar levels, %i accounts written. CmdAdj : error: command %s does not exist! Cmd_AddCommand after host_initializedCmd_AddCommand: %s already defined as a var Cmd_AddCommand: %s already defined usage: if [else ] valid operators are ==, =, !=, <>, >, <, >=, <=, isin, !isin Cmd_DeleteAlias: alias list brokenunalias : erase an existing alias exec : execute a script file ATTENTION: possibly tried to use ktpro's security hole, server don't run command after ';'! Command: %s  >?;MISSING VALUE Can't use a key with a \ \%s\%sCan't set * keys (,{})(':;=!><&|+Can't use keys or values with a \ Can't use keys or values with a " Keys and values must be < %d characters. Info string length exceeded (change: key = '%s', old value = '%s', new value = '%s', strlen info = '%d', maxsize = '%d') Full info string: '%s' Info string length exceeded (add: key = '%s', value = '%s', strlen info = '%d', maxsize = '%d') Full info string: '%s' SZ_GetSpace: %i/%i is > full buffer sizeSZ_GetSpace: overflow: cur = %i, len = %i, max = %i llf@=CM_PointInLeaf: numnodes == 0CM_InlineModel: bad nameCM_InlineModel: bad numbersource/cmodel.cleafCM_LoadMap: %s not foundCM_LoadMap: funny lump sizeMap with no modelsMap has too many modelsbackup past 0 !__extension__ ({ size_t __s1_len, __s2_len; (__builtin_constant_p (name) && __builtin_constant_p (map_name) && (__s1_len = strlen (name), __s2_len = strlen (map_name), (!((size_t)(const void *)((name) + 1) - (size_t)(const void *)(name) == 1) || __s1_len >= 4) && (!((size_t)(const void *)((map_name) + 1) - (size_t)(const void *)(map_name) == 1) || __s2_len >= 4)) ? __builtin_strcmp (name, map_name) : (__builtin_constant_p (name) && ((size_t)(const void *)((name) + 1) - (size_t)(const void *)(name) == 1) && (__s1_len = strlen (name), __s1_len < 4) ? (__builtin_constant_p (map_name) && ((size_t)(const void *)((map_name) + 1) - (size_t)(const void *)(map_name) == 1) ? __builtin_strcmp (name, map_name) : (__extension__ ({ __const unsigned char *__s2 = (__const unsigned char *) (__const char *) (map_name); register int __result = (((__const unsigned char *) (__const char *) (name))[0] - __s2[0]); if (__s1_len > 0 && __result == 0) { __result = (((__const unsigned char *) (__const char *) (name))[1] - __s2[1]); if (__s1_len > 1 && __result == 0) { __result = (((__const unsigned char *) (__const char *) (name))[2] - __s2[2]); if (__s1_len > 2 && __result == 0) __result = (((__const unsigned char *) (__const char *) (name))[3] - __s2[3]); } } __result; }))) : (__builtin_constant_p (map_name) && ((size_t)(const void *)((map_name) + 1) - (size_t)(const void *)(map_name) == 1) && (__s2_len = strlen (map_name), __s2_len < 4) ? (__builtin_constant_p (name) && ((size_t)(const void *)((name) + 1) - (size_t)(const void *)(name) == 1) ? __builtin_strcmp (name, map_name) : (__extension__ ({ __const unsigned char *__s1 = (__const unsigned char *) (__const char *) (name); register int __result = __s1[0] - ((__const unsigned char *) (__const char *) (map_name))[0]; if (__s2_len > 0 && __result == 0) { __result = (__s1[1] - ((__const unsigned char *) (__const char *) (map_name))[1]); if (__s2_len > 1 && __result == 0) { __result = (__s1[2] - ((__const unsigned char *) (__const char *) (map_name))[2]); if (__s2_len > 2 && __result == 0) __result = (__s1[3] - ((__const unsigned char *) (__const char *) (map_name))[3]); } } __result; }))) : __builtin_strcmp (name, map_name)))); })CM_LoadMap: %s has wrong version number (%i should be %i)CM_HullPointContents: bad node numberRecursiveHullTrace: bad node numberCM_LoadMapCM_Leafnum!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>cvarlisttoggleincranmapaddbots%c%c%c %s ------------ %d variables Cvar list brokenusage: set "%s" is a command Unknown variable "%s" "%s" is "%s" inc [value] %.8gInvalid "remove" argument. ---Bots in server:--- id# name --- ---- %i %s ---End of bot list.--- help---"bots" cvar help:--- error: invalid maxfps value -- use 0 to unset toggle : toggle a cvar on/off Cvar_Set: variable %s not found Can't register variable %s, already defined Cvar_Register: %s is a command Usage: Bots [add] | [remove] | [list] | [help] Usage: bots add [class#] [team#] No team specified, assuming 1.. Usage: bots remove [all]|[team]|[one] [team#]|[id#] -- Note: This feature requires your mod to have -- XavioR's (M)TF bot support functions - - "bots add": Adds a bot to a specific class & team - Usage: bots add [class#] [team#] - - "bots remove": Removes either a single bot, a team, or all bots - Usage: bots remove [all]|[team]|[one] [team#]|[id#] - - "bots list": Lists all bots on server bot bot id# and name - - "bots help": Displays this help segment Invalid usage of "bots" cvar. Usage: Addbots [class#] [team#]  Current search path: Error opening %sCOM_WriteFile: %s ?model?PackFile: %s : %s Couldn't reopen %sFindFile: can't find %s COM_LoadFile: bad usehunk%s is not a packfile%s has %i filesAdded packfile %s (%i files) %s/pak%i.pakpath-basedir%s/id1%s/qwCOM_LoadFile: not enough space for %sBoxOnPlaneSide: Bad signbitsC<-- s=%i(%i) a=%i(%i) %i %s:Dropped %i packets at %i %s:Outgoing message overflow --> s=%i(%i) a=%i(%i) %i showpacketsshowdropqport%s:Out of order packet %i at %i Gz?Gz?-ip-ipt%i.%i.%i.%i%i.%i.%i.%i:%ilocalhost127.0.0.10.0.0.0Couldn't detect local ip IP address %s TCP Initialized UDP Initialized sv_local_addrUDP_OpenSocket: socket: (%i): %s UDP_OpenSocket: setsockopt SO_REUSEADDR: (%i): %s UDP_OpenSocket: ioctl FIONBIO: (%i): %s Binding to IP Interface Address of %s UDP_OpenSocket: bind: (%i): %s TCP_OpenSocket: socket: (%i): %s TCP_OpenSocket: ioctl FIONBIO: (%i): %s Binding telnet service to IP Interface Address of %s TCP_OpenSocket: bind: (%i): %s TCP_OpenSocket: listen: (%i): %s NET_SendPacket: sendto: (%i): %s NET_Init: getsockname: (%i): %s Warning: Oversize packet from %s NET_GetPacket: Error 10054 from %s NET_GetPacket: recvfrom: (%i): %s {Gz?A?B%02XJanFebMarAprMayJunJulAugSepOctNovOct 12 2004MVDSV Project home page: http://mvdsv.sourceforge.net a pASOLID_BSP without MOVETYPE_PUSHSV_HullForEntity: ent.modelindex >= MAX_MODELSSOLID_BSP with a non-bsp model: classname: %s, netname: %s, target: %s, targetname: %s, model num: %iTrigger in clipping listZ_CheckHeap: block size does not touch the next blockZ_CheckHeap: next block doesn't have proper back linkZ_CheckHeap: two consecutive free blocksZ_TagMalloc: tried to use a 0 tagZ_Free: freed a pointer without ZONEIDCache_TryAlloc: %i is greater then free hunkCache_Alloc: already allocatedHunk_FreeToHighMark: bad mark %iHunk_FreeToLowMark: bad mark %i, hunk_low_used = %iZ_Malloc: failed on allocation of %i bytesHunk_HighAllocName: bad size: %iHunk_HighAlloc: failed on %i bytes Not enough RAM allocated. Try starting using "-mem 16 (or more)" on the command line. hunk_size = %i, hunk_low_used = %i, hunk_high_used = %i, size = %iMemory_Init: you must specify a size in KB after -zone :%8i total hunk size Not enough memory free; check disk spaceCache_MakeLRU: active linkCache_UnlinkLRU: NULL linkCache_Free: not allocatedHunk_Check: trashed sentinelHunk_Check: bad sizeZ_Free: NULL pointerZ_Free: freed a freed pointerflushcache_printcache_report%4.1f megabyte data cache %8i : %s Cache_Alloc: size %iCache_Alloc: out of memorytempHunk_Alloc: bad size: %i-zone------------------------- :%8i REMAINING %8p :%8i %8s :%8i %8s (TOTAL) %8i total blocks num name rep int commands --- --------------- --- ------ ------------------- TimerDel: removing timer "%s". TimerDel: no active timers to delete. use "timerlist" to view all active timers' names. TimerDel: successfully deleted timer "%s" TimerDel: couldn't find or delete timer "%s" TimerDel: timer user-created timer "%s" is automatically being removed because of account deletion. executing timer "%s" created by level %d account "%s" TimerAdd: error: timer name already exists. use another name. TimerAdd: error: too many timers. TimerAdd: level %d rcon user "%s" successfully created timer "%s". TimerAdd: successfully created timer "%s". usage: addtimer : The name to identify this timer. : Use 0 for an endless timer. : Interval in seconds between the timer's executions. : The commands to have this timer execute. TimerAdd: error: interval must be a positive integer. %3i %-15s %3i %6.1f %s no timers. freeing timer "%s" TimerDel: removed %i timers. usage: removetimer executing timer "%s" rcon_addrcon_addiprcon_delrcon_deliprcon_listrcon_userrcon_writeset_cmdLevelset_cvarLevelusage: rcon_user name: %s access: %i IPs: %3i.%3i.%3i.%3i RconAcct: user not found. No accounts. acct name lvl %s --- %-20s %i bad address: %i.%i.%i.%i %i.%i.%i.%i deleted. usage: rcon_del RconAcct: deleted %s if_filterbanif_filtermuteError: name or password is not unique. RconAcct: added %s to rcon list usage: rcon_addip RconAcct: no spaces open -- delete an IP first. RconAcct: bad address: %i.%i.%i.%i RconAcct: added %i.%i.%i.%i for account %s usage: rcon_delip WEIRD ERROR: deleting account %s RconAcct: error - user %s not in rcon list Changing command levels has been disabled by the admin usage: set_cmdLevel CmdAdj : "%s" is now level: "%d" CvarAdj : changing command levels has been disabled by the admin usage: set_cvarLevel CvarAdj : error: %s is a command CvarAdj : error: cvar "%s" does not exist! CvarAdj : "%s" is now level: "%d" usage: rcon_add RconAcct: error - level must be 1-5 RconAcct: error - password is not unique RconAcct: error - not enough memory to create account! 5.0 13-Sep-2004\ at end of pattern\c at end of patternunknown POSIX class nameblanknothing to repeatinvalid condition (?(0)number after (?C is > 255missing )erroffset passed as NULLunknown option bit(s) setmissing ) after commentclosing ) for (?C expectedsyntax error after (?Pmalformed number after (?(assertion expected after (?(parentheses nested too deeplyregular expression too largefailed to get memoryunmatched parenthesesinternal error: code overflowalphalowerupperalnumasciicntrlgraphpunctspacexdigit } g p T B 1 '                       v v v v v v v v v v v v v v v v v v : v : v v v v v v : v v v v v v v v v v v v v  v v v v v v v v : v v v v v v v v : v v E                                                                                          P                                                              B B     B T! T! T! T! T! T! T! T! T! T! T!      T! T! T!   T! T!     T!   T! T!     T!   T! T!     T!         0! 0!     ! ! ! ! =% =% $ $ $ =% =% $ $ $ $ :% $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ ? - .  .  . . 6 R- }- - - pA 25 W) W) W)  @ =- = = > 8 R5 5 + + + + + + 5 5  6 ;6 ;6 ;6 ;6 ;6 ;6 }6 }6 1 3 3 3 3 3 3 4 4  5 W) W) W) W) W) W) W) W) . . W) o9 > 8 ) @@ @@ @@ s* * s* * , 6 8 - 0> C= - ) x[ l\ \ ` ` ` ` [ H  J 7L PN gP R T G a a Eb b 1c c d d { x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x { y { x x `~ x x x x x x x x x x x x x x x x ~ x x x x x x x x x x x x x x x x x x x x x x x x x x x *| } x } x x x x x x x x x x x x x x x x x x x x x x x x x x x x ~ {   ̔             / / / / / / / / / /   . g                     )    ?  ş       , ,                    ,                            H ť